PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G067500.2
Common NamePOPTR_0013s06390g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 294aa    MW: 33186.1 Da    PI: 6.3711
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G067500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-143782148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Potri.013G067500.2 37 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 82
                        89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-91842IPR009057Homeodomain-like
PROSITE profilePS500904.1351831IPR017877Myb-like domain
SuperFamilySSF466897.39E-211889IPR009057Homeodomain-like
PROSITE profilePS5129423.0443286IPR017930Myb domain
SMARTSM007173.5E-133684IPR001005SANT/Myb domain
PfamPF002494.8E-133782IPR001005SANT/Myb domain
CDDcd001677.90E-93982No hitNo description
Gene3DG3DSA:1.10.10.601.3E-204387IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEYTNGSIYL VACKGLLRCS KSCRLRWTNY LRPGIKRGNF TPHEEGMIIH LQALLGNKWA  60
AIASYLPQRT DNDIKNYWNT HLKKKLKKFQ SALDPMAQGS ASSQFMSKSF NERKCLDDFT  120
TDSSVLNRPN QVSTYASSTE NISRLLEGWM RSSPKPNGTD LLKENWEKNN NSLENNGHSF  180
GNSVATNSLQ SYRPKPEEES GDLISHEEFE SILSLENLNN VAWDKSSCDS ATVVTTTKDF  240
KSSTSDEKAN ITMTERKQKS DESTPPLSFL EKWLLDENGS VQVEEIMELS PIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1628624108B-MYB
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269|PubMed:22018045}.
UniprotTISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269|PubMed:22018045}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.013G067500.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1826770.0AC182677.2 Populus trichocarpa clone Pop1-29G16, complete sequence.
GenBankEF1488270.0EF148827.1 Populus trichocarpa x Populus deltoides clone WS0138_M09 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319734.10.0myb-related protein 306
SwissprotB3VTV79e-96MYB60_VITVI; Transcription factor MYB60
TrEMBLB9I6600.0B9I660_POPTR; Uncharacterized protein
STRINGPOPTR_0013s06390.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-62myb domain protein 60
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]