PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G066700.1
Common NamePOPTR_0013s06290g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 495aa    MW: 53797.4 Da    PI: 6.9878
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G066700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.7e-39100159261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         ++k+l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grrknk+ 
  Potri.013G066700.1 100 PDKILPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGSMRNVPIGAGRRKNKHL 159
                         7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3093157IPR003851Zinc finger, Dof-type
PfamPF027011.1E-31102158IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.733104158IPR003851Zinc finger, Dof-type
PROSITE patternPS013610106142IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MKGESKDPAF KLFGRKIPVP DTQFPAEPLA KGTCSEITRV ETKGPSEDIS EEPEMFSGSG  60
QGKEESQAAM RVNEAQVIAK HKEGPLETNG TDQEKVLKKP DKILPCPRCN SLDTKFCYFN  120
NYNVNQPRHF CKNCQRYWTA GGSMRNVPIG AGRRKNKHLA TQYRQILVSS DGMPIARMEN  180
SDSIGHQLQS SVESGTTLSP SVANGMVLKF GHEAPLCDSM ENVLNLGDQK RYVEISSVNR  240
QDNVEEPSSC GSSKTASNAW ANELRENIMQ KEQVDVPASS NELSAPNSLP YYSVPSWVFP  300
WNPGWNNVAS MTAAQHSTGQ ACVTNIPNQV QLCSTPMLAV PSICPPNIPL QFVPASYWGC  360
MPTWAAGTRN VSLSGSNGCL SLSTSANTSS CSGNGSPTLG KHSRDSKFME EEKAEKCILV  420
PKTLRIDDPS EASKSPLWAT LGLKPDQKDP ASKGTIFKNF ETKAECYGHV SDITHVLEAN  480
PAALSRSHTF QESG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.013G066700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319195.20.0cyclic dof factor 3 isoform X1
RefseqXP_024439742.10.0cyclic dof factor 3 isoform X2
TrEMBLA0A2K1Y2170.0A0A2K1Y217_POPTR; Uncharacterized protein
TrEMBLA0A3N7FVM20.0A0A3N7FVM2_POPTR; Uncharacterized protein
STRINGPOPTR_0013s06290.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.26e-63cycling DOF factor 2