PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G059600.1
Common NamePOPTR_0013s05610g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 296aa    MW: 32672.6 Da    PI: 6.9853
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G059600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.72.8e-17227261135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C++C +  Tp+WR gp g+ktLCnaCG++y++ +l
  Potri.013G059600.1 227 CTHCLAQRTPQWRAGPLGPKTLCNACGVRYKSGRL 261
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.596221257IPR000679Zinc finger, GATA-type
SMARTSM004015.1E-14221275IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-15222285No hitNo description
Gene3DG3DSA:3.30.50.101.4E-13225259IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.18E-11226273No hitNo description
PfamPF003205.8E-15227261IPR000679Zinc finger, GATA-type
PROSITE patternPS003440227252IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MDFCRNVTVS TEYHQQEKVL ASPPPCSKLG AAAAALTATT SPLDDPFSAQ NTEVDFSSEW  60
LSVFVEDCLS STGNYLPAPT VEAQKPNTEE NPPKNWQRKP QDQEDPSSLK KLVIPGKSRS  120
KRRRLPGDKT RNPLTSWCYT NQAFNNLTSS DPPLLQQTYW LADSELIMPI KEDSNNTDMD  180
NEVQEESGVG VHDEDIGKVV AVVGSNGSKD SLGVLESNNG QQQPRRCTHC LAQRTPQWRA  240
GPLGPKTLCN ACGVRYKSGR LLPEYRPAKS PTFVSYLHSN SHKKVMEMRM AGFNT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120124KRRRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.90280.0bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.013G059600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319169.30.0GATA transcription factor 2
TrEMBLA0A2K1Y1N90.0A0A2K1Y1N9_POPTR; Uncharacterized protein
STRINGPOPTR_0013s05610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84872444
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.16e-36GATA transcription factor 12