PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G048000.2
Common NamePOPTR_0013s04530g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 431aa    MW: 48287.3 Da    PI: 5.4812
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G048000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.12.3e-34202256155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l++m+v+gLt++hvkSHLQkYR+
  Potri.013G048000.2 202 KPRMRWTPELHEAFVEAVNQLGGSERATPKGVLKHMNVEGLTIYHVKSHLQKYRS 256
                         79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.194199259IPR017930Myb domain
SuperFamilySSF466895.47E-19200256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.8E-32201258IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-24202256IPR006447Myb domain, plants
PfamPF002493.9E-11204255IPR001005SANT/Myb domain
PfamPF143797.1E-23283329IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MMRNSASQQA SSLSPGNRSV GPLFSSSSRF SNDMHVSSVS PQGRQSHNSP FISQSLRDRG  60
NFTPTHDSHS EVQSTEFIAY SDENKDLSWP VDPLQDLLDF AGNVHVQNGQ VESSAGVFAS  120
EDHAKRTDWQ EWADQLISVD DELEPNWSEI LNDVNKTDSR QKELKPSPNI SVKQPPIHQH  180
QTAHSGEVCA VANPLSAAPT TKPRMRWTPE LHEAFVEAVN QLGGSERATP KGVLKHMNVE  240
GLTIYHVKSH LQKYRSARYK PESSDEKKTS PIEEMKSLDL KTMGITEALR LQMEVQKRLH  300
EQLEIQRNLQ LRIEEQGRHL QEMFEKQRKI EDDKSKAPSS SQDDPSPLQA KLEQSSANYK  360
LEASELDLVK TSNESALLEE SSQSISRKQK APEERNDQVL DQIDEESSPA PIKRPRRDET  420
AELSTGAASN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-29202260260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-29202260260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-29202260260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-29202260260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-29202260260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-29202260260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-29202260260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-29202260260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots. {ECO:0000269|PubMed:20838596}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.013G048000.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024439692.10.0protein PHR1-LIKE 1 isoform X2
SwissprotQ8GUN55e-98PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLB9I5P90.0B9I5P9_POPTR; Uncharacterized protein
STRINGPOPTR_0013s04530.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.32e-98G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  4. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]