PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G014000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 149aa    MW: 16491.4 Da    PI: 8.0801
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G014000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR132.52.9e-1080130455
                FAR1   4 neYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtr 55 
                         ++YAk vGF+ r+++s+k k++g i +  +vCskeg ++++ kk +k rr++
  Potri.013G014000.1  80 KSYAKAVGFQWRTRTSRKDKNKGGICTVSMVCSKEGANKSRGKK-NKLRRPT 130
                         68***************************************999.4444433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.7E-780128IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MDRLLIGHEI GLNATPFLER QHLSTSNDGS GVEEEDEEEG KEKEEAGHSS LPNGTENPLT  60
QSPYDGQVFR CLQALVPHLK SYAKAVGFQW RTRTSRKDKN KGGICTVSMV CSKEGANKSR  120
GKKNKLRRPT SKEGANNFFL EKGWLVED*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.013G014000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011036894.16e-25PREDICTED: histone acetyltransferase KAT6B-like
TrEMBLA0A2K1XZD61e-106A0A2K1XZD6_POPTR; Uncharacterized protein
STRINGPOPTR_0005s02350.12e-24(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.16e-07FAR1-related sequence 5