PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G139300.1
Common NamePOPTR_0012s13390g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 749aa    MW: 82431.5 Da    PI: 5.5728
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G139300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.11e-2053108156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         r+k  ++t++q++eLe++F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
  Potri.012G139300.1  53 RKKYNRHTANQIQELESFFKECPHPDEKQRSELSRRLGLESKQIKFWFQNRRTQMK 108
                         79999************************************************999 PP

2START176.22e-552584792205
                         HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                         la++a++el+k+a+ e+p W ks     e +n +e++++f++ +     + +ea r+sgvv  +   lve+l+d++  W e+++    +a+
  Potri.012G139300.1 258 LALAAMDELIKMAQIESPIWIKSLdggkEVLNHEEYTRTFPRIGMkpsnFVTEATRVSGVVLVNISALVETLMDVN-GWVEMFPsliaRAA 347
                         6899**********************9999**********8866699999**************************.************** PP

                         EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
               START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                         t++ issg      galq + ae+q++sp vp R + f+R ++ql++g+w++vdvS+d +q++ + +  v +++lpSg++i+++ ng skv
  Potri.012G139300.1 348 TTDIISSGmggtksGALQMIHAEFQLISPFVPvRQVKFLRLCKQLTEGVWAVVDVSIDANQENLNAQAPVTCKRLPSGCIIQDMNNGCSKV 438
                         ***************************************************************998888889******************* PP

                         EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
               START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                         twveh +++++ +h+l+r++++sg+ +ga++w+a+lqr+ e
  Potri.012G139300.1 439 TWVEHSEYDESAVHQLYRPILSSGRGFGAQRWLAALQRYYE 479
                         *************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.09E-1939110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-2240110IPR009057Homeodomain-like
PROSITE profilePS5007118.25350110IPR001356Homeobox domain
SMARTSM003891.5E-1852114IPR001356Homeobox domain
PfamPF000462.8E-1853108IPR001356Homeobox domain
CDDcd000869.61E-1953110No hitNo description
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
PROSITE profilePS5084837.884248483IPR002913START domain
SuperFamilySSF559618.15E-31249479No hitNo description
CDDcd088754.78E-111252476No hitNo description
SMARTSM002341.4E-39257480IPR002913START domain
PfamPF018521.3E-47258478IPR002913START domain
SuperFamilySSF559615.71E-15508744No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 749 aa     Download sequence    Send to blast
MDGRGDMGLF GEHFDPCLVG RIKEDGYESR SGSDNIEGAS GEDQDVGDDQ RPRKKYNRHT  60
ANQIQELESF FKECPHPDEK QRSELSRRLG LESKQIKFWF QNRRTQMKTQ LERHENVILR  120
QDNDKLRLEN ELLKQNMSDP ICNNCGGPVV PGPVSDEQQQ LRIENARLTD ELGRVCALAN  180
KFLGRPLTSS ANPIPPFSTN SKLDLAVGIN GYGNLGHTDN MLPMGLDNNR GIMMPLMKPI  240
GNAVGKEVPH DRSIFVDLAL AAMDELIKMA QIESPIWIKS LDGGKEVLNH EEYTRTFPRI  300
GMKPSNFVTE ATRVSGVVLV NISALVETLM DVNGWVEMFP SLIARAATTD IISSGMGGTK  360
SGALQMIHAE FQLISPFVPV RQVKFLRLCK QLTEGVWAVV DVSIDANQEN LNAQAPVTCK  420
RLPSGCIIQD MNNGCSKVTW VEHSEYDESA VHQLYRPILS SGRGFGAQRW LAALQRYYEG  480
MAMIMSPSIL GEDQTVINLG GKKSMLKLAR RMVDNFCSGV CASSLHNWGN LVAGNVSEDV  540
RILTRKSINE PGEPDGIVLS AATSVWLPVS RQRLFDFLRD EQSRSHWDIL SNGGMLQEII  600
QIPKGQGQCN RVSLLRSTAV DADAGENNML ILQETRNDVS GSQVVYAPVD IQSMSVVTSG  660
GDSTYVALLP SGFVILPDNS FSNGEPSNSD GNPVKRDSDS NNGGGSFFTV GFQILASNLP  720
SAKLTVESVE TIHNLISCTM QRIRTAFN*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G139300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024438602.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9I4A90.0B9I4A9_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13390.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]