PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G137500.2
Common NamePOPTR_0012s13550g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 862aa    MW: 99483.9 Da    PI: 6.2438
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G137500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR182.66.7e-2645131188
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                         +fYn+YAk+vGFsvrk+  ++sk +g +++r+f+Cskeg+r+++k++  + +++r+etrtgC a++ v+++ d+k++vt++e eHnH+
  Potri.012G137500.2  45 RFYNKYAKTVGFSVRKDWVNRSKVHGLVVSRKFTCSKEGYRRKDKRD-LNVKKHRKETRTGCLAHMIVTRQPDAKYRVTHFEAEHNHD 131
                         5*******************************************999.99999**********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.2E-2345131IPR004330FAR1 DNA binding domain
PfamPF105512.0E-27255349IPR018289MULE transposase domain
PROSITE profilePS509669.507535571IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
GO:0016788Molecular Functionhydrolase activity, acting on ester bonds
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MTDCRSLNFA LVNSSQFSNS SKDGVNIGGV LKIGTEFESD EHAYRFYNKY AKTVGFSVRK  60
DWVNRSKVHG LVVSRKFTCS KEGYRRKDKR DLNVKKHRKE TRTGCLAHMI VTRQPDAKYR  120
VTHFEAEHNH DNIDPNNAES QLLWREIHVD QAAEGDLPSN SGTESSSTFE LVNRQFEVWK  180
SLDQLAMDFD NSLRSQRIRD MKEGEAGRLL RYFQRQHIEN PSFIHSIQVD IDDKVSNIFW  240
ADDKMVVDYD HFGDVVCLDT SYRMNKDLQP FVQFIGVNHH NQAIIFAAAL LFDDTVESLK  300
WLFNTFLEAM SGKKPKVILT DQDAAIVEAI NSILPETSHR ICVWQMYQNA LKHLSLVVKD  360
MESFSNDFRS CIYDYNNEEA FVHAWEGLLD KYGLQQNDRL RWMFREREKW SIAYGRNTFF  420
LDMKGSHVAE DLSNNLRSYL NSDQDALQIY KIFERVADEQ RFKETHANDE MTRSMPRLLG  480
NVALLKHASG IYTPKAFELF QKEYEKCLNV VVTQCNEKGF LLEYKVSTFG QTQEYTVIFN  540
SADDTVVCNC MKFENVGFLC GHALKVLDNW NIKVVPSRYI LKRWTKDTRL GRVRDSGEFT  600
AKENLKLAVA SRYKDLCRNI IKISARAAES EDAFQFALRQ LDELIEGVEK ILMLKAEEGQ  660
GITSSSTVVN GFESENAEFF LDEEEIEDQG EDNRVDGTKE KESAAPDRHQ LKNINEKSCK  720
KKRFQLGQTP SPNTSSCISS PPQARVMTEG QSHNPLLQGL YNFEANQVVQ CMYQQQNPVM  780
DHEDNPNMYQ QSVFYADQHV SPTQIPLLQE PLIRSAYHES LTNNALFRQA MDLDLQHPQS  840
SSFLLYDHRF RTFDTSYLGL K*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G137500.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006377078.20.0protein FAR1-RELATED SEQUENCE 5 isoform X2
TrEMBLA0A3N7FUN90.0A0A3N7FUN9_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13550.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-112FAR1-related sequence 5