PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G137500.1
Common NamePOPTR_0012s13550g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family FAR1
Protein Properties Length: 1108aa    MW: 127102 Da    PI: 6.0929
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G137500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR182.19.3e-2660146188
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                         +fYn+YAk+vGFsvrk+  ++sk +g +++r+f+Cskeg+r+++k++  + +++r+etrtgC a++ v+++ d+k++vt++e eHnH+
  Potri.012G137500.1  60 RFYNKYAKTVGFSVRKDWVNRSKVHGLVVSRKFTCSKEGYRRKDKRD-LNVKKHRKETRTGCLAHMIVTRQPDAKYRVTHFEAEHNHD 146
                         5*******************************************999.99999**********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031014.4E-2360146IPR004330FAR1 DNA binding domain
PfamPF105512.8E-27270364IPR018289MULE transposase domain
PROSITE profilePS509669.507550586IPR007527Zinc finger, SWIM-type
PfamPF006571.2E-98731069IPR001087GDSL lipase/esterase
Gene3DG3DSA:3.40.50.11101.7E-418821074IPR013830SGNH hydrolase-type esterase domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
GO:0016788Molecular Functionhydrolase activity, acting on ester bonds
Sequence ? help Back to Top
Protein Sequence    Length: 1108 aa     Download sequence    Send to blast
MEIGLQKSDK LDLNLDQDCR SLNFALVNSS QFSNSSKDGV NIGGVLKIGT EFESDEHAYR  60
FYNKYAKTVG FSVRKDWVNR SKVHGLVVSR KFTCSKEGYR RKDKRDLNVK KHRKETRTGC  120
LAHMIVTRQP DAKYRVTHFE AEHNHDNIDP NNAESQLLWR EIHVDQAAEG DLPSNSGTES  180
SSTFELVNRQ FEVWKSLDQL AMDFDNSLRS QRIRDMKEGE AGRLLRYFQR QHIENPSFIH  240
SIQVDIDDKV SNIFWADDKM VVDYDHFGDV VCLDTSYRMN KDLQPFVQFI GVNHHNQAII  300
FAAALLFDDT VESLKWLFNT FLEAMSGKKP KVILTDQDAA IVEAINSILP ETSHRICVWQ  360
MYQNALKHLS LVVKDMESFS NDFRSCIYDY NNEEAFVHAW EGLLDKYGLQ QNDRLRWMFR  420
EREKWSIAYG RNTFFLDMKG SHVAEDLSNN LRSYLNSDQD ALQIYKIFER VADEQRFKET  480
HANDEMTRSM PRLLGNVALL KHASGIYTPK AFELFQKEYE KCLNVVVTQC NEKGFLLEYK  540
VSTFGQTQEY TVIFNSADDT VVCNCMKFEN VGFLCGHALK VLDNWNIKVV PSRYILKRWT  600
KDTRLGRVRD SGEFTAKENL KLAVASRYKD LCRNIIKISA RAAESEDAFQ FALRQLDELI  660
EGVEKILMLK AEEGQGITSS STVVNGFESE NAEFFLDEEE IEDQGEDNRV DGTKEKESAA  720
PDRHQLKNIN EKSCKKKRFQ LGQTPSPNTS SCISSPPQAR VMTEGQSHNP LLQVVQCMYQ  780
QQNPVMDHED NPNMYQQSVF YADQHVSPTQ IPLLQEPLIR SAYHESLTNN ALFRQLSTII  840
DNVSVTTDNM ILLYGKGQRY TMDFQLYNHK IIASRIAKEL GGADVAKKYL GQCIYAVETG  900
YNDYLNNYYG EGYNTSNIYT PEQFSQLLVQ TYEIQLERLY NEGARKVAVF GLIRIGCMPA  960
YKQIFGANES SCVDKLNHAA QLFNNELQKA LPKLNANLPG AKFTYINSYE IDSENYTDLG  1020
FKFTNKSCCD VPSDQIPCAA LTYPCLNRDE HVYWDGAHYT EARARIFAKR AYKRQFPVDA  1080
YPYDISELAK VPNDEADGCS TCGSKIL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G137500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024437515.10.0protein FAR1-RELATED SEQUENCE 5 isoform X1
RefseqXP_024437516.10.0protein FAR1-RELATED SEQUENCE 5 isoform X1
TrEMBLA0A3N7FYC10.0A0A3N7FYC1_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-110FAR1-related sequence 5