PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G133800.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 624aa    MW: 68307.8 Da    PI: 9.0794
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G133800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like74.21.8e-23178231155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kp+++Wt+ LH+rF+ a++++ G +kA+Pk+ile+m+v gL++e+++SHLQkYR+
  Potri.012G133800.2 178 KPKVVWTNSLHNRFLLALNHI-GLDKAVPKRILECMSVRGLSRENIASHLQKYRI 231
                         79*******************.********************************6 PP

2Response_reg49.81.9e-17149923108
                         CEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHH CS
        Response_reg  23 yeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelv 108
                         + +v +++++ +al +l+ k+  +Dl++ D+ mp+m+G+el k+ +ee  klp+i++++ ++++ + + l+ Ga  +++Kp ++ +l 
  Potri.012G133800.2  14 L-IVVTVKKPFDALSILRLKKglFDLVVSDLHMPEMNGMELQKQVEEEF-KLPVIIMSSDESKNVISRSLEGGAAFYIVKPANKVDLK 99 
                         5.78899**********888889**********************9999.*******************************9998886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011027.3751106IPR001789Signal transduction response regulator, receiver domain
SMARTSM004485.3E-61102IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.43E-151101No hitNo description
Gene3DG3DSA:3.40.50.23001.1E-214113No hitNo description
SuperFamilySSF521727.12E-1912107IPR011006CheY-like superfamily
PfamPF000721.9E-1415100IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.1E-21157166No hitNo description
Gene3DG3DSA:1.10.10.603.9E-24175235IPR009057Homeodomain-like
SuperFamilySSF466892.15E-17176235IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-24178231IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MLSSLLTDNR NLELIVVTVK KPFDALSILR LKKGLFDLVV SDLHMPEMNG MELQKQVEEE  60
FKLPVIIMSS DESKNVISRS LEGGAAFYIV KPANKVDLKN VWHYAVAIKT GNSLSIKEIE  120
GSREPSYSST LVERLSLEDV NSATSINDEK RYRKNGRKEE RKSTKDDQEV DSQPASKKPK  180
VVWTNSLHNR FLLALNHIGL DKAVPKRILE CMSVRGLSRE NIASHLQKYR IFLKKVAERG  240
GCSSKNLSGR DDLRTNFAPS QPFMMFKNVQ QEYSQRVTRA SIQPGLGGNT IPALGGSSFR  300
NLHSPNQQAP SNNSILQSPY GQSRLFGNAN SANQANQIRS GLESNYSIGE NMPSYGGVIP  360
NGLTHGTRPM QMYHPQNQAR SYLQNFGSPP LINRFGAVGI QATNYGSGVG DIGIINNSLN  420
TNNNYVGIRV TTDGRLIGSG QMQLNTNELS NGFSDGGHPC LMNWARNGNM NVASIGFNIA  480
SENYVARRGS FSAGFEGANQ FFPPTPFTSV YHGNSTPMLL PPPPPQHQLG LGNGGQNDFV  540
FGLMNNSPPI LGGNSNQQPQ IGEGEPNVSD MLLEPTNNPP AYQLPQGVAQ MSTPLHELLT  600
PDFLNSLHID DNTPRNEQPS SQA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-22175237264ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G133800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318255.30.0putative two-component response regulator ARR21
TrEMBLA0A2K1YD570.0A0A2K1YD57_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13900.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-49response regulator 2