PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G133700.1
Common NamePOPTR_0012s13910g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 155aa    MW: 17211.5 Da    PI: 7.4326
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G133700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.12.3e-4151041100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+C++dC+++pyfp+++p++fa+vh+++Gasnv k+l++lp + r +a++sl+yeA+ r++dPvyG+vg+i+ l+qq++ ++
  Potri.012G133700.1   5 RCAACKYLRRRCPSDCIFSPYFPSNNPQRFACVHRIYGASNVAKMLQQLPAHLRAEAANSLYYEAQSRTQDPVYGCVGIISLLHQQIHGVE 95 
                         6****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++la++k+e
  Potri.012G133700.1  96 SQLAKTKAE 104
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9634105IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-415102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MISGRCAACK YLRRRCPSDC IFSPYFPSNN PQRFACVHRI YGASNVAKML QQLPAHLRAE  60
AANSLYYEAQ SRTQDPVYGC VGIISLLHQQ IHGVESQLAK TKAEIAVLNS LAQEPAQIQE  120
NEVEASFNHF LLEQDNIASG QYFSHSTCIP SNFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-38610512111LOB family transfactor Ramosa2.1
5ly0_B3e-38610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G133700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318256.21e-112LOB domain-containing protein 24
SwissprotP594676e-53LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594685e-53LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9I4F91e-111B9I4F9_POPTR; Uncharacterized protein
STRINGPOPTR_0012s13910.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-55LOB domain-containing protein 24