PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G132300.1
Common NamePOPTR_0012s14050g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 995aa    MW: 111294 Da    PI: 7.1743
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G132300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix25.14.4e-082292832175
            trihelix  21 lrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtses 75 
                         + rgk ++ + +ev++++ ++ ++r +k+   kw+n+ ++++k+ e+e++ + e+
  Potri.012G132300.1 229 STRGKTRADKDREVAEFLNRHDVHRDAKTAGTKWDNMLGEFRKVYEWERGDKREQ 283
                         56788999999**************************************974433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561121.46E-15840977IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.105.8E-6844939No hitNo description
CDDcd001803.16E-12850977No hitNo description
Gene3DG3DSA:1.10.510.100.001946984No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 995 aa     Download sequence    Send to blast
MGENKGETTK KQQQQQLSSS TSPSPKGPIE ESTELRSLHH QQTTSAVVTG APFIPAPLFV  60
PIGATSSPFE QHFETVNPKR ARYSSAQWKL LPSASQQQQP PTQAQMATVV SSEATPSLIT  120
NPTQQKQPRT TAEASSSDTN SSPLRSPVPS LSAASAQETS KPEGEPHQHQ FRKGKYVSPV  180
WKPNEMLWLA RAWRFQYQGG SDLTSRVEQL PETTTGQVTS GDTAIAVQST RGKTRADKDR  240
EVAEFLNRHD VHRDAKTAGT KWDNMLGEFR KVYEWERGDK REQMGKSYFR LSPYERKAHR  300
LPASFDEEVF EELSQFMGPK MRTQSRGPSL SGSGDDSSRG TSLAAARALP PPPPFKEDDL  360
SLSGRTRQLV LTSGGEAYFH GTRGSLLGFD TAVDAAAGSS SSTKELRRIG KVRMTWEESV  420
SLWGEEGEHH RGRVRLQGSS FLNADELTFF DDSMVACTME AFEDGALKGF SVDKFVSGQQ  480
IKVFGRRKPS PSASVTPSGF TERVQLPLTE PSIRLPPWEF QDPTEYYVGC LRVPPTTLPS  540
LFELSWYLQE PPPEELRFPL RRDVYRDLPQ GKELFFTISN DPLDCRGITY DILSSIIRTN  600
PSISGATSSS RDSFIGVWDD CINRIVSKFC SVEVVIVRKQ PSSPMVDTLQ DEWPNVTGFV  660
RNFCLWRGEE TDQLREGQVD PSSSIIEKLL WTYLDLPYIL GYYAVGYSVT FCALCRSQDR  720
IIRTDLYSLD LSSPVERLKA LVPCYRVAGL LPLLADRCFN NFNNGGTYKQ LAFSDFERVD  780
MGNGNIMEMT PNTVTRLFSS RRKWAAVKEI YDCLDHRIPH AEFIYRSSEK DLALVFKPRG  840
LKFKPNNCEQ LVEALKYVTQ ALVALHDLSF MHRDLSWDKV MRRSDSENEW FLSGFDDAVG  900
APQLNPVHGI GEARGRHAPE MGRGMHGVKV DVWGVGHLVR TCGLGPNGVP KILRELQNRC  960
LDQNPEQRPT AADCYHHLLQ VQSSLQSSSP GVPY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318853.10.0hypothetical protein POPTR_0012s14050g
TrEMBLB9I4H20.0B9I4H2_POPTR; Uncharacterized protein
STRINGPOPTR_0012s14050.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP947967
FabidsOGEF118572831
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.17e-07Trihelix family protein