PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G109900.1
Common NamePOPTR_0012s11170g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 391aa    MW: 44604.4 Da    PI: 8.0087
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G109900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF551e-171153345
                        --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        i  +  r  tf kR++g+lKKA+E S+LC+++++viif++++k
  Potri.012G109900.1 11 IRKEKSRMLTFRKRKAGLLKKASEFSILCGVDACVIIFGPKQK 53
                        56677899********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.96E-19188IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.054153IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-19166IPR002100Transcription factor, MADS-box
CDDcd002669.11E-23270No hitNo description
PRINTSPR004045.6E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-181153IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MGQKRIKMEL IRKEKSRMLT FRKRKAGLLK KASEFSILCG VDACVIIFGP KQKDDHQPVA  60
PETWPPNSEE VRCIINRYKG SDQPRRCYQV SDYFVDKKKQ IDSELARLHK QIIKAKYPAW  120
DDRLNSLYAD QLRVLVGHLD AKIDLADKKL GSFNANQYVM GAPGVQAASL SPSISHDMES  180
YMKSRDDNFL QLIHNSNPFD AQPPMVFYPE QSSHVTNLME RNYSNGYSAD LQVYYEPRPL  240
DDQLPVGFQS KQTSHGTTRN ASFWESNNGN CYSTDLQLYL EPNPLNVQPP MHFQPKQNAH  300
RTSSYLHAME DAIMKMACDQ YTSDQFGCKL SSSSNLPCVN RTPWMWDNVW FNNADSSVSY  360
IAPTKQPIMP SIQFPMSSFP HQMQSSEASD *
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G109900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2977060.0KC297706.1 Populus tomentosa AGL24 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318787.30.0agamous-like MADS-box protein AGL62
TrEMBLA0A2K1YC130.0A0A2K1YC13_POPTR; Uncharacterized protein
STRINGPOPTR_0012s11170.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Representative plantOGRP3677621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.19e-30M-type_MADS family protein