PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G093900.1
Common NamePOPTR_0012s09550g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 517aa    MW: 57548.9 Da    PI: 6.1645
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G093900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.12.9e-1131445151374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfsevsP 89 
                         lv+lL++cAeav+ +d++ a+alL++l+ +a   g+++qR+a++f+++L  rl+  ++  +  + + + +  +  s+++  al+l +e++P
  Potri.012G093900.1 144 LVQLLIACAEAVACRDKSHASALLSELRSNALVFGSAFQRVASCFVQGLIDRLSLVQPLGAVGFVAPTMNIIDiaSDKKEEALRLVYEICP 234
                         689**************************************************98444333333333333333569999999********* PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvp 175
                          ++f+h++aN+ Ilea+ege+ vH++D++++    +G QW  L+q+La+R+++pp +lRiTgvg       ++ + +g+ L+++A+ +g++
  Potri.012G093900.1 235 HIRFGHFVANNSILEAFEGESSVHVVDLGMTlglpHGHQWRLLIQSLAERAGKPPsRLRITGVGL----CVDRFRIIGDELEEYAKDMGIN 321
                         ***************************98873333788*************888879********....********************** PP

                GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysa 266
                         +ef+v v ++le+l++e+++++++E+l+Vn++lqlh +++es    +   +vL+++ +lsPkv+v+veq+++hn++ Fl rf+eal+yysa
  Potri.012G093900.1 322 LEFSV-VKSSLENLRPEDIKTSEDEVLVVNSILQLHCVVKESRGALN---SVLQIILELSPKVLVLVEQDSSHNGPFFLGRFMEALHYYSA 408
                         ****9.799******************************88877777...8**************************************** PP

                GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesg 356
                         +fdsl++ lp+ +  r+k+E++++++ei+n+v+ceg +r+erhe++ +Wr+r+++aGF+ +p++  +++qak  l + k  dgy+v ee+g
  Potri.012G093900.1 409 IFDSLDTMLPKYDTRRAKMEQFYFAEEIKNIVSCEGPARVERHERVDQWRRRMSRAGFQVAPIK--MMAQAKQWLVQSKvCDGYTVVEEKG 497
                         **************************************************************97..677888888888889********** PP

                GRAS 357 slvlgWkdrpLvsvSaWr 374
                         +lvlgWk++p++++S+W+
  Potri.012G093900.1 498 CLVLGWKSKPIIAASCWK 515
                         *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.918118496IPR005202Transcription factor GRAS
PfamPF035149.9E-111144515IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MAHSFLSREF NDETLSETSG LDLSLAAMAC YPHPYLPIFE SNVVSRMLPF SDETRDVKRI  60
KQSSSMVESI RSNGSSLYSG GSSICRSSST NSLNNIPKLH FRDHIWTYTQ RYLAAEAVEE  120
AAAAMINAEE GGNEEEGNSD GMRLVQLLIA CAEAVACRDK SHASALLSEL RSNALVFGSA  180
FQRVASCFVQ GLIDRLSLVQ PLGAVGFVAP TMNIIDIASD KKEEALRLVY EICPHIRFGH  240
FVANNSILEA FEGESSVHVV DLGMTLGLPH GHQWRLLIQS LAERAGKPPS RLRITGVGLC  300
VDRFRIIGDE LEEYAKDMGI NLEFSVVKSS LENLRPEDIK TSEDEVLVVN SILQLHCVVK  360
ESRGALNSVL QIILELSPKV LVLVEQDSSH NGPFFLGRFM EALHYYSAIF DSLDTMLPKY  420
DTRRAKMEQF YFAEEIKNIV SCEGPARVER HERVDQWRRR MSRAGFQVAP IKMMAQAKQW  480
LVQSKVCDGY TVVEEKGCLV LGWKSKPIIA ASCWKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-501445154375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318703.10.0hypothetical protein POPTR_0012s09550g
TrEMBLB9I3M10.0B9I3M1_POPTR; Uncharacterized protein
STRINGPOPTR_0012s09550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP70521119
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-81RGA-like 1