PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G072000.1
Common NamePOPTR_0012s07390g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 270aa    MW: 30796.3 Da    PI: 5.313
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G072000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.21.2e-3710107198
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCa+Ck++rrkC+++C+lapyfp+eqpk f+n+hklFG++++l++l++l+  ++e+am+s++y++++r r Pv+G++g+i +l+ q++q++
  Potri.012G072000.1  10 ACASCKYQRRKCSSECPLAPYFPSEQPKMFQNAHKLFGVRKILRILENLDYLQKEEAMRSIIYQSNIRDRFPVHGCLGIIYQLHFQIRQAE 100
                         7****************************************************************************************** PP

              DUF260  92 aelallk 98 
                         +el ++ 
  Potri.012G072000.1 101 EELRAVY 107
                         **98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.6239110IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-3510106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MTLKGGTSQA CASCKYQRRK CSSECPLAPY FPSEQPKMFQ NAHKLFGVRK ILRILENLDY  60
LQKEEAMRSI IYQSNIRDRF PVHGCLGIIY QLHFQIRQAE EELRAVYAHL EMYRQHHHHQ  120
IAALTEDVPS QLELGMALPQ PCLAQQYSYS ISSNIGYSSG YLDSNDNVGN QLWSQHPYAT  180
NSNTNYTPII QSQLDASQPL STQQEIVQDY DEMHSFFDTI DDRQSYIETK EPYESSSEES  240
LKDTTQSMEH VAENELKSAA ACFSLTSVN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2561147113LOB family transfactor Ramosa2.1
5ly0_B1e-2561147113LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.127140.0bud| catkin
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G072000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006376825.10.0LOB domain-containing protein 27
RefseqXP_024438108.10.0LOB domain-containing protein 27
SwissprotQ9STS64e-63LBD27_ARATH; LOB domain-containing protein 27
TrEMBLU5FZC10.0U5FZC1_POPTR; Uncharacterized protein
STRINGPOPTR_0012s07390.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-56LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]