PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G070900.1
Common NamePOPTR_0012s07270g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 318aa    MW: 35494 Da    PI: 4.4532
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G070900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-1989142356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t +q++ Le+ Fe ++++  e++ +LAk lgL+ rqV +WFqNrRa++k
  Potri.012G070900.1  89 KKRRLTVDQVQFLERSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWK 142
                         56689************************************************9 PP

2HD-ZIP_I/II128.33.1e-4188179192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ +qv++LE+sFe e+kLeperK +la++Lglqprqva+WFqnrRAR+ktkqlEkdye+L+++y+ lk++ ++L ke+e+L++e+
  Potri.012G070900.1  88 EKKRRLTVDQVQFLERSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYEVLQSSYNGLKADYDNLFKEKEKLKAEV 178
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Potri.012G070900.1 179 N 179
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.7E-2071146IPR009057Homeodomain-like
PROSITE profilePS5007117.32984144IPR001356Homeobox domain
SMARTSM003892.8E-1987148IPR001356Homeobox domain
CDDcd000864.48E-1889145No hitNo description
PfamPF000461.2E-1689142IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-1991151IPR009057Homeodomain-like
PRINTSPR000311.3E-5115124IPR000047Helix-turn-helix motif
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5124140IPR000047Helix-turn-helix motif
PfamPF021832.3E-16144185IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MAACGGGGGG SNPNLSVLVQ SQRGPCAASQ PLEAFFLSGS SPSFLGSRSM MSFADVHQAN  60
GSTRPFFRPY DHEDNGDDDL DEYFHQPEKK RRLTVDQVQF LERSFEVENK LEPERKIQLA  120
KDLGLQPRQV AIWFQNRRAR WKTKQLEKDY EVLQSSYNGL KADYDNLFKE KEKLKAEVNL  180
LTNELLLKEK EKGSSELSDK DALSQEPPKK AIADSASEGE VSKTSTVACQ QEDISSAKSD  240
MFDSDSPHFA DGVHSSLLEA GDSSHVFEPD QSDLSQDEED NLSKSLLPPY VFPKLEDGDY  300
SDPPASFEDH AFWCWSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136144RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.53460.0bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G070900.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1478220.0EF147822.1 Populus trichocarpa clone WS0125_E07 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317992.20.0homeobox-leucine zipper protein HAT5
TrEMBLB9I3080.0B9I308_POPTR; HD-ZIP family protein
STRINGPOPTR_0012s07270.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15003499
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.18e-43homeobox 1