PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G063800.1
Common NamePOPTR_0012s12670g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 330aa    MW: 36234.5 Da    PI: 6.8604
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G063800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.2e-383190261
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                        +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  Potri.012G063800.1 31 NQQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 90
                        6899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-273089IPR003851Zinc finger, Dof-type
PfamPF027012.6E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6183589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MQDTHSIGGG GRLFSGGGGG DRKLRPHHHQ NQQALKCPRC DSLNTKFCYY NNYNLSQPRH  60
FCKSCRRYWT KGGVLRNVPV GGGCRKTKRS RPKQNTPITT CDTITASSTT PQELQEQHQQ  120
RDHKSSDSHS SSESSSLTAT NNTNANTTAE AVSALSVSSV VSNNLLNGIV ESKIFPHGNV  180
NPSFEPSLLE QGSDCGIFSE IGSFTSLITS TNDLFGFSNM MSQHQPPHQQ QGLEHHVQHN  240
QNQQQWQNHQ QQEMTGGGGL IDQTVHVELS ALPSSRSTKN DDGEFGALDW QLGSGDQATS  300
LFDLPNAVDQ AYWSQSQWND QDHPSLYIP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1917GGRLFSGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.87020.0bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G063800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2091050.0AC209105.1 Populus trichocarpa clone POP086-P02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317948.10.0dof zinc finger protein DOF5.4
TrEMBLB9I2T10.0B9I2T1_POPTR; Uncharacterized protein
STRINGPOPTR_0012s12670.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-39OBF binding protein 4