PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G047700.1
Common NamePOPTR_0012s04510g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 388aa    MW: 43971.7 Da    PI: 5.7976
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G047700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.82.8e-2185144357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         +R+++t+eql++Leel+++ +r+ps++++++++++l    +++ ++V++WFqN++a+e++
  Potri.012G047700.1  85 SRWNPTPEQLRTLEELYRRgTRTPSTDQIQDITAQLrrygRIEGKNVFYWFQNHKARERQ 144
                         7*****************99**************************************97 PP

2Wus_type_Homeobox115.23.3e-3784146365
   Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ++RW+PtpeQ++ Leely++G+rtP++++iq+ita+L++yG+ie+kNVfyWFQN+kaRerqk+
  Potri.012G047700.1  84 SSRWNPTPEQLRTLEELYRRGTRTPSTDQIQDITAQLRRYGRIEGKNVFYWFQNHKARERQKR 146
                         79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.4E-582149IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-885144IPR009057Homeodomain-like
PfamPF000465.9E-1985144IPR001356Homeobox domain
SuperFamilySSF466893.94E-1285150IPR009057Homeodomain-like
CDDcd000861.89E-686146No hitNo description
PROSITE profilePS5007111.04690145IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MWMMGYNDSG DFDMPDSFND RKLKTLVPRP LPSTNNTSTA SGHPCPGSRL HSTDFLALNQ  60
YHLGLASMVD QGIREFNTQP VVMSSRWNPT PEQLRTLEEL YRRGTRTPST DQIQDITAQL  120
RRYGRIEGKN VFYWFQNHKA RERQKRRRQM ESDSLDDHQQ NGHGVEMFER KEPGASMTGY  180
EGEQTRNWAP STNCSTLSEE SVSISKATKA AMAEYYRPDG WIEFDEGEIM QHRRNLIERN  240
ATWEMMPFSC PSPTHLLNTI SSATATTIAT TSASTQGAAT VRTMDPTKLM NAHDLNIFIA  300
PYIENGYHGA RINHFNNSVI NEGGEYCRDG NDESQTLQLF PIRSGGNGNN IERINERETE  360
VSVSATETLN ANDFSPCQFF EFLPLRI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G047700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9826990.0KF982699.1 Populus tomentosa WOX1a (WOX1a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024438050.10.0WUSCHEL-related homeobox 1
TrEMBLA0A2K1Y9060.0A0A2K1Y906_POPTR; Uncharacterized protein
STRINGPOPTR_0012s04510.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Representative plantOGRP8416716
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.15e-52WUSCHEL related homeobox 1