PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G042100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 437aa    MW: 47609.8 Da    PI: 7.9549
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G042100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32249302255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Potri.012G042100.1 249 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLSHVKSHLQMYRT 302
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15246303IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28247303IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-24249302IPR006447Myb domain, plants
PfamPF002496.0E-7250301IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MSQKRIFDKQ SLNLIPDLSL HISLPNSAPS SICTGTNDSD SAFDIWLKDD GLKSHSDSSI  60
RVGSQADTEL SLANPTNTAL EAESPWRRNF CGSGTGSVEG HHGQARQRNL LLQCSGNGQM  120
SHINHGISIL DVTGLKPIKG IPVYNSWNSS GDIDPRFSLN QMPYSPSCTP YSSSNPSADH  180
HKSPFQAYRK DTAAPRFNGM SMDTLRAPQY HQYGAAGVGS GPGAEVYGSG MIRSRFMPKL  240
QNKRSMRAPR MRWTSSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL SHVKSHLQMY  300
RTVKSTDCRP AASSDGSGDE DFMPGTACFN QNANYLLTQK GGSNVPNLQH DNGFSHSPTT  360
LWSNSSSKGG GWHNSSRDLD GLKGEALSSQ QVSGNKLDGV GFAQSRSFTG FNQELKNPIL  420
EISLGRPEYW QNEEHE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-17250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-17250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-17250304357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-17250304357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G042100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024437724.10.0transcription repressor KAN1 isoform X1
TrEMBLA0A2K1Y8N80.0A0A2K1Y8N8_POPTR; Uncharacterized protein
STRINGPOPTR_0012s03900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-58G2-like family protein