PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G038300.4
Common NamePOPTR_0012s03530g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 480aa    MW: 52989 Da    PI: 6.4428
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G038300.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.6e-185397147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        r +WT eE++++++a k++G g W++I +++g ++t+ q++s+ qky
  Potri.012G038300.4 53 REKWTDEEHQRFLEALKLYGRG-WRRIQEHVG-TKTAVQIRSHAQKY 97
                        789*******************.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-1747101IPR009057Homeodomain-like
PROSITE profilePS5129421.85948102IPR017930Myb domain
TIGRFAMsTIGR015571.2E-1651100IPR006447Myb domain, plants
SMARTSM007171.5E-1352100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-105399IPR009057Homeodomain-like
PfamPF002491.1E-155397IPR001005SANT/Myb domain
CDDcd001672.15E-115598No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MEGTNLNSFG KACDFGTNSC EQSETDIRMQ ELYSFGSDNV PKVRKPYTIT KQREKWTDEE  60
HQRFLEALKL YGRGWRRIQE HVGTKTAVQI RSHAQKYFSK VVREPGGINE SSLKPIEIPP  120
PRPKRKPAHP YPRKPVNVLE VTGASSQLER SPSPNSSVSE KENQSPTSVL SALASDTFGS  180
ALSEPCNACS SPTSCTTEMH SISLSPSAKE TEHGTSNSSG EEKGNLSLVQ MSLSLLENFL  240
SEVKKFELGS KNTVCAEHDA AKKASSASIK LFGMTVKIVD SQKESPPGAE IVLPVISNEN  300
HDNVDADKEK PAHTLQRKQS DTELSLGMAN SNQNLWPSPA SVFHCTEMQG DNANYFATNS  360
SIPWWTLCQG VPFLYLTSND HTSAQKPIPC VEERFEEKEI LNERSCTSSN VFSVGDLENG  420
ERNLDVDSQC GQPSVEGTSS LQKSTRGFVP YKRCLGERDV KSTVIISEER ERQRARVYS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G038300.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1484100.0EF148410.1 Populus trichocarpa x Populus deltoides clone WS01314_I10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317724.10.0protein REVEILLE 7
TrEMBLB9I4X50.0B9I4X5_POPTR; Uncharacterized protein
STRINGPOPTR_0012s03530.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.13e-45MYB_related family protein