PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G038300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 597aa    MW: 66311.9 Da    PI: 6.5964
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G038300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-1761105147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT eE++++++a k++G g W++I +++g ++t+ q++s+ qky
  Potri.012G038300.1  61 REKWTDEEHQRFLEALKLYGRG-WRRIQEHVG-TKTAVQIRSHAQKY 105
                         789*******************.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-1655109IPR009057Homeodomain-like
PROSITE profilePS5129421.85956110IPR017930Myb domain
TIGRFAMsTIGR015571.6E-1659108IPR006447Myb domain, plants
SMARTSM007171.5E-1360108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-1061107IPR009057Homeodomain-like
PfamPF002491.4E-1561105IPR001005SANT/Myb domain
CDDcd001673.21E-1163106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MAAASKEQME GTNLNSFGKA CDFGTNSCEQ SETDIRMQEL YSFGSDNVPK VRKPYTITKQ  60
REKWTDEEHQ RFLEALKLYG RGWRRIQEHV GTKTAVQIRS HAQKYFSKVV REPGGINESS  120
LKPIEIPPPR PKRKPAHPYP RKPVNVLEVT GASSQLERSP SPNSSVSEKE NQSPTSVLSA  180
LASDTFGSAL SEPCNACSSP TSCTTEMHSI SLSPSAKETE HGTSNSSGEE KGNLSLVQMS  240
LSLLENFLSE VKKFELGSKN TVCAEHDAAK KASSASIKLF GMTVKIVDSQ KESPPGAEIV  300
LPVISNENHD NVDADKEKPA HTLQRKQSDT ELSLGMANSN QNLWPSPASV FHCTEMQGDN  360
ANYFATNSSI PWWTLCQGVP FLYLTSNDHT SAQKPIPCVE ERFEEKEILN ERSCTSSNVF  420
SVGDLENGER NLDVDSQCGQ PSVEGTSSLQ KSTRGFVPYK RCLGERDVKS TVIISEERER  480
QRARFIHGAP FKSPYVLAYK RCFWMQMMLI DCSTFLQFHV AIVSEVEQSG VLLEALRGVD  540
KSHTGFIILI HISELELSHQ TIKEELHLCP LLLIVLVARH SLLQLFQTLI YFCTSL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G038300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1484100.0EF148410.1 Populus trichocarpa x Populus deltoides clone WS01314_I10 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317724.10.0protein REVEILLE 7
TrEMBLA0A385JIG20.0A0A385JIG2_POPTO; Early-phytochrome-responsive 1
STRINGPOPTR_0012s03530.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73133244
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.12e-44MYB_related family protein