PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G023700.1
Common NamePOPTR_0012s03080g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 276aa    MW: 31398 Da    PI: 5.6932
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G023700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-1978129556
                         SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++f++eq++ Le++Fe++ ++  +++ +LA++lgL+ rqV +WFqNrRa++k
  Potri.012G023700.1  78 RRFSDEQVRSLESMFESETKLEPRKKMQLARELGLQPRQVAIWFQNRRARWK 129
                         58*************************************************9 PP

2HD-ZIP_I/II123.21.3e-3977167393
         HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                          rr+s+eqv++LE++Fe+e+kLep++K++lareLglqprqva+WFqnrRAR+ktkq+E++y++Lk++yd+l+++ e+L++e e+L  +l++
  Potri.012G023700.1  77 TRRFSDEQVRSLESMFESETKLEPRKKMQLARELGLQPRQVAIWFQNRRARWKTKQMEQKYKTLKASYDNLASSYESLKNERESLLLQLQT 167
                         69***********************************************************************************988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1870133IPR009057Homeodomain-like
PROSITE profilePS5007117.62171131IPR001356Homeobox domain
SMARTSM003891.7E-1774135IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-2078138IPR009057Homeodomain-like
PfamPF000465.6E-1778129IPR001356Homeobox domain
CDDcd000865.61E-1778132No hitNo description
PRINTSPR000315.7E-6102111IPR000047Helix-turn-helix motif
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PRINTSPR000315.7E-6111127IPR000047Helix-turn-helix motif
PfamPF021831.5E-12131172IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MHTSHINLLM DRFILTYCNM SYQILIEGVV DFDQAVAGDH AEAAESFACV DDDDHQQQLE  60
QISRRKKKKK KGSKMNTRRF SDEQVRSLES MFESETKLEP RKKMQLAREL GLQPRQVAIW  120
FQNRRARWKT KQMEQKYKTL KASYDNLASS YESLKNERES LLLQLQTVSN QLGNPCKGLE  180
RCDRGIDEVL HDGITNLEVE AQQGQDNSTI MANVCDDMSM GNGHSGDQGQ GFLYTGSPEY  240
SDGTLASAYE KCYSTDSGAP FDLSWNNSYC FSFRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16369RRKKKKK
26470RKKKKKK
3123131RRARWKTKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G023700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2091840.0AC209184.1 Populus trichocarpa clone POP031-J16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317813.20.0homeobox-leucine zipper protein ATHB-12
TrEMBLA0A2K1Y7S80.0A0A2K1Y7S8_POPTR; Uncharacterized protein
STRINGPOPTR_0012s03080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120052635
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.11e-44homeobox 7