PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G022600.2
Common NamePOPTR_0012s02950g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 536aa    MW: 58252.6 Da    PI: 7.9289
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G022600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.52.7e-24182224244
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                          epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Potri.012G022600.2 182 LEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 224
                         69***************************************97 PP

2QLQ46.11.5e-16133165234
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                         +FT++Q+ +L++Q+++y y+ a++PvPp+ l +
  Potri.012G022600.2 133 PFTNTQWKELERQAMIYNYITASVPVPPQFLIP 165
                         8****************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.0E-9132168IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.195133168IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.6E-10133164IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.596181225IPR014977WRC domain
PfamPF088792.4E-20183224IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MMTTDDGLNV SNKVAKEINT TSSISNVDFG VKLHQPIDHH QSFPSSTPMM VPHVNHHRPM  60
FDNGPTSSCD RNKSLMNYIS DRIYRVAAGG ATSGGAVGVR NLQPFDISET SISTAASAFR  120
SPGGNMAASL GFPFTNTQWK ELERQAMIYN YITASVPVPP QFLIPTPMGN GLNVRFSNGA  180
DLEPGRCRRT DGKKWRCSRD VAPDQKYCER HMHRGRPRSR KHVELNASNN NNKKNRHNPA  240
ICPEAPVTVA ISKPTINNSN SGSASHDQFF GPMPQPYIQT PVFVNKTSEK TSTYDVNGAY  300
GSTFKEPRSL DWMLKGEAGP IAKNDQQWPH LVHKEIELAT EGSFNSASVL KQHYQGESLN  360
LNSFGNFNAR EDQQSNQYSL FLDEAPRSFI DAWSNDAISR NTSSVSSDGK LHLSPLSLSM  420
GSNRSTDDEM GQIQMGLGLI KSDRNEECGN TSSAPGGPLA EVLQLRTSNT TGTNQSSSMM  480
ENGDSISPPA TTVSSPSGVL QKTLASFSDS SGNSSPTLAS SRTKPEIAML WLNQG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G022600.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024437935.10.0growth-regulating factor 4
TrEMBLA0A2K1Y7R00.0A0A2K1Y7R0_POPTR; Uncharacterized protein
STRINGPOPTR_0012s02950.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.15e-37growth-regulating factor 7