PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G022600.1
Common NamePOPTR_0012s02950g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 581aa    MW: 63297.6 Da    PI: 8.3909
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G022600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.43e-24227269244
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                          epgrCrRtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Potri.012G022600.1 227 LEPGRCRRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 269
                         69***************************************97 PP

2QLQ461.6e-16178210234
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                         +FT++Q+ +L++Q+++y y+ a++PvPp+ l +
  Potri.012G022600.1 178 PFTNTQWKELERQAMIYNYITASVPVPPQFLIP 210
                         8****************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.0E-9177213IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.195178213IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-10178209IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.596226270IPR014977WRC domain
PfamPF088792.7E-20228269IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MMTTDDGLNV SNKVAKEINT TSSISNVDFG VKLHQPIDHH QSFPSSTPMM VPHVNHHRPM  60
FDNGPTSSCD RNKSLMNYIS DRIYRVAAGG ATSGGAVGVR NLQPFDISET SISTAASAFR  120
SPGCRKISLF FLSISPLSTS SCFSLLVSLS FSLLNFQRLN LYESKSQGGN MAASLGFPFT  180
NTQWKELERQ AMIYNYITAS VPVPPQFLIP TPMGNGLNVR FSNGADLEPG RCRRTDGKKW  240
RCSRDVAPDQ KYCERHMHRG RPRSRKHVEL NASNNNNKKN RHNPAICPEA PVTVAISKPT  300
INNSNSGSAS HDQFFGPMPQ PYIQTPVFVN KTSEKTSTYD VNGAYGSTFK EPRSLDWMLK  360
GEAGPIAKND QQWPHLVHKE IELATEGSFN SASVLKQHYQ GESLNLNSFG NFNAREDQQS  420
NQYSLFLDEA PRSFIDAWSN DAISRNTSSV SSDGKLHLSP LSLSMGSNRS TDDEMGQIQM  480
GLGLIKSDRN EECGNTSSAP GGPLAEVLQL RTSNTTGTNQ SSSMMENGDS ISPPATTVSS  540
PSGVLQKTLA SFSDSSGNSS PTLASSRTKP EIAMLWLNQG *
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G022600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024437935.10.0growth-regulating factor 4
TrEMBLA0A2K1Y7R00.0A0A2K1Y7R0_POPTR; Uncharacterized protein
STRINGPOPTR_0012s02950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Representative plantOGRP1109257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-36growth-regulating factor 7