PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G020200.1
Common NamePOPTR_0012s02710g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 436aa    MW: 49432.5 Da    PI: 7.4224
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G020200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS400.61.6e-122384341373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.......sseelaal... 81 
                         +++lL++cA+ +s++d ++a+++ + ls ++sp+gd+++Rl++ f +AL+ rl++++ +++ a ++   + +n              +   
  Potri.012G020200.1  38 MRQLLVSCADLISQSDYSAAKRFFSILSSNSSPYGDSTERLVHQFIRALSLRLNGHGISTSTAPAAHVFNINNmvtsrpcG------Tndk 122
                         589****************************************************65555555555444444433444440......0455 PP

                GRAS  82 ..............kl..fsevsPilkfshltaNqaIleave.geervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgvgspe 151
                                       ++  +++++P+++f+hltaNqaIlea++ g++++HiiDfdi++G+QWp+L+qaLa+R+    ++pp+lRiTg g+  
  Potri.012G020200.1 123 mlisyeadqetlrsCYlsLNKITPFIRFCHLTANQAILEAIQvGQQAIHIIDFDIMHGVQWPPLMQALAERSnntlHPPPMLRITGTGH-- 211
                         555567777766652257***********************94669**************************777777***********.. PP

                GRAS 152 sgskeeleetgerLakfAeelgvpfefnvl.....vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPk 237
                           + + l++tg+rL kfA++lg++f+f++l       ++l+   ++++ + p+EalaVn+v  lhr+l+++         +L+ +k l+Pk
  Potri.012G020200.1 212 --DLNVLHRTGDRLLKFAQSLGLRFHFHPLlllnnDPTSLAHYLPSAITLLPDEALAVNCVSYLHRFLKDDSREL---LLFLHKIKALNPK 297
                         ..9**************************9775322235666689999********************6555444...59*********** PP

                GRAS 238 vvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvp 328
                         vv+v+e+ea+hn++ Fl+rfleal++y+alfdslea+lp++s+er  vE+ ++grei+++va+eg+ rrerh+++e+W+++l+++GF +vp
  Potri.012G020200.1 298 VVTVAEREANHNHPLFLQRFLEALDHYTALFDSLEATLPPNSRERLAVEQIWFGREIMDIVAAEGEGRRERHQRFETWEMMLKSVGFIKVP 388
                         ******************************************************************************************* PP

                GRAS 329 lsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                         ls +a +qaklllr ++ sdgy+++  ++s++lgW++++L+svS+W
  Potri.012G020200.1 389 LSPFALSQAKLLLRLHYpSDGYQLQILNNSFFLGWRNHSLFSVSSW 434
                         ********************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.38512414IPR005202Transcription factor GRAS
PfamPF035145.5E-12038434IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010223Biological Processsecondary shoot formation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MLGSWSQLQT QSQLMSSSNS HDRHQEEETP GPPTAFHMRQ LLVSCADLIS QSDYSAAKRF  60
FSILSSNSSP YGDSTERLVH QFIRALSLRL NGHGISTSTA PAAHVFNINN MVTSRPCGTN  120
DKMLISYEAD QETLRSCYLS LNKITPFIRF CHLTANQAIL EAIQVGQQAI HIIDFDIMHG  180
VQWPPLMQAL AERSNNTLHP PPMLRITGTG HDLNVLHRTG DRLLKFAQSL GLRFHFHPLL  240
LLNNDPTSLA HYLPSAITLL PDEALAVNCV SYLHRFLKDD SRELLLFLHK IKALNPKVVT  300
VAEREANHNH PLFLQRFLEA LDHYTALFDS LEATLPPNSR ERLAVEQIWF GREIMDIVAA  360
EGEGRRERHQ RFETWEMMLK SVGFIKVPLS PFALSQAKLL LRLHYPSDGY QLQILNNSFF  420
LGWRNHSLFS VSSWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-58404346374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090440.0AC209044.1 Populus trichocarpa clone POP057-J01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318447.10.0LATERAL SUPPRESSOR family protein
SwissprotQ9ZWC51e-142SCL18_ARATH; Scarecrow-like protein 18
TrEMBLB9I2030.0B9I203_POPTR; LATERAL SUPPRESSOR family protein
STRINGPOPTR_0012s02710.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP54911421
FabidsOGEF129262133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.11e-144GRAS family protein