PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G018700.1
Common NamePOPTR_0012s02570g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 298aa    MW: 32791.1 Da    PI: 7.8949
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G018700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.67.3e-403394263
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                        k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Potri.012G018700.1 33 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTAGGSLRNVPVGGGSRKNKRSSS 94
                        7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-252582IPR003851Zinc finger, Dof-type
PfamPF027018.1E-343491IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3013791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MDTATQWAQG IGAVNPMEGS RPDVLERRAR AQKDQALNCP RCNSTNTKFC YYNNYSLSQP  60
RYFCKTCRRY WTAGGSLRNV PVGGGSRKNK RSSSTASTSA AGAAASKKFP LDLTQPNLPH  120
SASQNPKIHE GQDLNLAYPP SADDYSNLSE FVEIPFDTES NKTHHQNPNP SSTSPSHHHH  180
HHVSPMEFLK STAMNSRGFS AFMSIPPLSD SNNTMFSTGF PLQEFKSTQN FSLEGLESGY  240
SNTQGVHETC GSARLLFPIE DLKQQVPSNT EFEQNTREQR DSAPVGYWNG MLGGGSW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G018700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9717091e-39AB971709.1 Nicotiana tabacum NtBBF2 mRNA for Dof zinc finger protein, complete cds, cultivar: Samsun NN.
GenBankAB9717121e-39AB971712.1 Nicotiana tabacum NtBBF2 gene for Dof zinc finger protein, partial cds, cultivar: Samsun NN.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317793.30.0dof zinc finger protein 1
TrEMBLA0A2K1Y7I60.0A0A2K1Y7I6_POPTR; Uncharacterized protein
STRINGPOPTR_0012s02570.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.47e-40Dof family protein