PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G016800.1
Common NamePOPTR_0012s02390g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 250aa    MW: 29131.4 Da    PI: 6.1666
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G016800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.92.6e-25141188552
              RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++le+++++F++pi++AA+e++v+lTvLK++CR++ I+RWPhRkiksl
  Potri.012G016800.1 141 LELEEIQRHFNMPITQAAREMKVGLTVLKKRCRELRIMRWPHRKIKSL 188
                         899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.722119209IPR003035RWP-RK domain
PfamPF020421.8E-22141188IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MENPLDFYQA WVLDDQDIFN KISELPPLES LFEPLNLPPF VPYDKNFNGF KNNEVINNDN  60
IFSESNLDSW YNQENAIDTK PVINPSIHPS YCLNLDNNVI KSELLNEVSM MLVQSDCASS  120
SSMKEEEEVR KMSGRKRSVG LELEEIQRHF NMPITQAARE MKVGLTVLKK RCRELRIMRW  180
PHRKIKSLTS LINNVKEMGL SEYEAIMLEE HKRLIEELPD LELTERTKKL RQACFKANYK  240
KRRLSAAYS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.012G016800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318433.10.0protein RKD4
TrEMBLB9I1X30.0B9I1X3_POPTR; Uncharacterized protein
STRINGPOPTR_0012s02390.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.14e-41RWP-RK domain-containing protein