PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G131100.1
Common NamePOPTR_0011s13460g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 578aa    MW: 64558.9 Da    PI: 6.2388
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G131100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.11.1e-1292075761373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+a+++++ +  ++l+++ +  +s +g+p+qRl ay++e+L ar  +s++++y+al+++e +    ++ l+++++++e++P+l
  Potri.011G131100.1 207 LKQLLIACAKALAENKVNDFDKLIEKARSVVSISGEPIQRLGAYLVEGLVARKESSGTNIYRALRCKEPE---GKDLLSYMHTLYEICPYL 294
                         689******************************************************************9...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         kf++++aN aI ea  +e+++Hi+Df i qG+QW++LlqaLa+Rp+g+p++RiTg+++p s+  + + l ++++rL+ + e++++p+ef+ 
  Potri.011G131100.1 295 KFGYMAANGAIAEACRNEDHIHIVDFHIAQGTQWMTLLQALAARPGGAPHVRITGIDDPVSKyaRGDGLDAVARRLTAISEKFNIPIEFHG 385
                         ***********************************************************999999************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          v     d++ e+++v+pgEalaVn+ l+lh+++desv+++++rd +L+++ksl+Pkvv++veqe+++n+++Fl+rf+e+l+yy a+f+s+
  Potri.011G131100.1 386 -VPVYAPDVTKEMFDVRPGEALAVNFPLELHHTPDESVDVNNPRDGLLRMIKSLNPKVVTLVEQESNTNTTPFLTRFVETLNYYLAMFESI 475
                         .688999************************************************************************************ PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         ++ lpr+++eri+vE+++l+r+ivnv+aceg+er+erhe ++kW++r+++aGF++ pls+++++ +++llr ++ + y++ e +g+++lgW
  Potri.011G131100.1 476 DVRLPRNQKERISVEQHCLARDIVNVIACEGKEREERHELFGKWKSRFMMAGFRQCPLSSYVNSVIRSLLRCYS-EHYTLVEIDGAMLLGW 565
                         **********************************************************************9999.66************** PP

                GRAS 363 kdrpLvsvSaW 373
                         kdr+L+s+SaW
  Potri.011G131100.1 566 KDRNLISASAW 576
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.144181558IPR005202Transcription factor GRAS
PfamPF035143.9E-127207576IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MESHQYFGYG VTGAGLSYSS SYPSVPSMPN RLFGSLKLDI GNSTSSPFST EFDCDTYATT  60
LCDSQDRYSS TENLSGESSS YFSRLNPSVD CQRESLLLFP GGTSLLQDAS SSHNIKHTLL  120
KLETTLMGPD DDEDVNTPNT CLGGSSRPPT SDQKPRAWSQ QREGSHVIQT QTSFVSRQRQ  180
FGEGAHVEKR QKEMEEVHFH GIPSGDLKQL LIACAKALAE NKVNDFDKLI EKARSVVSIS  240
GEPIQRLGAY LVEGLVARKE SSGTNIYRAL RCKEPEGKDL LSYMHTLYEI CPYLKFGYMA  300
ANGAIAEACR NEDHIHIVDF HIAQGTQWMT LLQALAARPG GAPHVRITGI DDPVSKYARG  360
DGLDAVARRL TAISEKFNIP IEFHGVPVYA PDVTKEMFDV RPGEALAVNF PLELHHTPDE  420
SVDVNNPRDG LLRMIKSLNP KVVTLVEQES NTNTTPFLTR FVETLNYYLA MFESIDVRLP  480
RNQKERISVE QHCLARDIVN VIACEGKERE ERHELFGKWK SRFMMAGFRQ CPLSSYVNSV  540
IRSLLRCYSE HYTLVEIDGA MLLGWKDRNL ISASAWY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-612045761374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317558.10.0hypothetical protein POPTR_0011s13460g
SwissprotQ69VG10.0CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLB9I0720.0B9I072_POPTR; Uncharacterized protein
STRINGPOPTR_0011s13460.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8948915
FabidsOGEF42993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50600.11e-175scarecrow-like 5