PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G114500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 214aa    MW: 24526.3 Da    PI: 6.9545
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G114500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.32.3e-1763115456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + ++t++q++ Le+ F  ++++  e + +LA++lg++ rq+ +W+qN+Ra++k
  Potri.011G114500.1  63 KKRLTHDQVRLLERTFTTTKKLEPELKVQLANQLGVPPRQIAIWYQNKRARWK 115
                         5679************************************************9 PP

2HD-ZIP_I/II107.69.2e-3562153293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         +k+rl+++qv+lLE++F++++kLepe Kv+la++Lg+ prq+a+W+qn+RAR+kt+ lE dy++L+++++   ++++rLe+ev +L+eel+
  Potri.011G114500.1  62 NKKRLTHDQVRLLERTFTTTKKLEPELKVQLANQLGVPPRQIAIWYQNKRARWKTQSLELDYNSLHAKLEDALADRRRLEREVVQLQEELR 152
                         79**************************************************************************************998 PP

         HD-ZIP_I/II  93 e 93 
                         +
  Potri.011G114500.1 153 R 153
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.29E-1737118IPR009057Homeodomain-like
PROSITE profilePS5007115.30557117IPR001356Homeobox domain
SMARTSM003894.4E-1459121IPR001356Homeobox domain
CDDcd000862.15E-1363118No hitNo description
PfamPF000469.9E-1563115IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-1863124IPR009057Homeodomain-like
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDDNCSETPF LPYKKGNELI NFFKQHNFQD NYFPQLNSPT SIAMDFFHSQ NQHSPKHQNS  60
SNKKRLTHDQ VRLLERTFTT TKKLEPELKV QLANQLGVPP RQIAIWYQNK RARWKTQSLE  120
LDYNSLHAKL EDALADRRRL EREVVQLQEE LRRAQQMVFH LNQGPAQPPV NVSSNSSCDE  180
GGSSSLHEEA NGEVLQLEEL YACLYGAGGS TWG*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and flowers. {ECO:0000269|PubMed:16055682}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G114500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2375850.0AC237585.1 Populus trichocarpa clone POP011-E13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011029534.11e-134PREDICTED: homeobox-leucine zipper protein ATHB-52-like
SwissprotQ9FN293e-42ATB52_ARATH; Homeobox-leucine zipper protein ATHB-52
TrEMBLA0A3N7HFD21e-123A0A3N7HFD2_POPTR; Uncharacterized protein
STRINGPOPTR_0011s11510.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110112239
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.16e-33homeobox protein 52