PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G102100.2
Common NamePOPTR_0011s10360g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family STAT
Protein Properties Length: 589aa    MW: 66574.2 Da    PI: 5.6071
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G102100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT195.55.1e-612193361118
                STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipk 91 
                         ldvvllna++q+++k++e+vasL+yad+gl+vek++d+e+pLL+s+dG+ef ++dr+ kll+Gras+klkisqLsskcdnrLfrik+eipk
  Potri.011G102100.2 219 LDVVLLNAMSQAINKELEIVASLVYADNGLPVEKTSDDEDPLLTSCDGIEFFNYDRQGKLLHGRASLKLKISQLSSKCDNRLFRIKLEIPK 309
                         8****************************************************************************************** PP

                STAT  92 lkkypfleavskpirCisrsrntrsss 118
                         ++ y+flea+s+pirCisrsrn r+s 
  Potri.011G102100.2 310 FSGYHFLEAFSHPIRCISRSRNPRTSL 336
                         **********************99764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.120.2001.7E-515144IPR013320Concanavalin A-like lectin/glucanase domain
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MGSRNTNNVI NRKDYILLKD FRMEIEVENE KDLSLSFWVY LIDSSTTTFP ATIIKQVYPD  60
ITSCAPFLVL NEKIITLFPL LHAHKETTNS SNSTSMEIKC PLENWIHVGF EVLTDIFRLH  120
INGEIVSEQP HSSSLDKNWN SNGLRKIALV GSCADDGLQG YVYHAEVLPL SLSIKDHYVK  180
DPPPWLSIDL SSTSEIDEDN DGIWNIVGGK ASCRRIFSLD VVLLNAMSQA INKELEIVAS  240
LVYADNGLPV EKTSDDEDPL LTSCDGIEFF NYDRQGKLLH GRASLKLKIS QLSSKCDNRL  300
FRIKLEIPKF SGYHFLEAFS HPIRCISRSR NPRTSLTWKR PTSVAEPFNK SQSFGLYNGS  360
IELQHNSIHE IRPSPSSKRI KLGQEKTSTM EKPDVECYSD AWTTNQVENA PRIPLDRGAE  420
NVEEADNSPS VSDSIEERLS DFNITSSSSY LISDVTIFKY CLGGLTDRAL LLKEVATSAS  480
EEELFRLANE VSLYSGCSHH RRQIVIAKRL IEEGTKVWNS ISQNNRLIHW ENVIFEIEEQ  540
FMRITCSSTR SLTEKVAFSS PSSCTHCEHT RTPCCYLHVE DDMLVAWK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G102100.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2080851e-125AC208085.1 Populus trichocarpa clone JGIACSB05-D05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024467295.10.0SH2 domain-containing protein A isoform X1
TrEMBLA0A2K1YI630.0A0A2K1YI63_POPTR; Uncharacterized protein
STRINGPOPTR_0011s10360.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-126SH2 domain protein B