PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G067200.1
Common NamePOPTR_0011s07270g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 156aa    MW: 17388.2 Da    PI: 5.0909
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G067200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.31.1e-3089142255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+ekAtPk + +lm+v  L+++hvkSHLQ+YR+
  Potri.011G067200.1  89 PRLRWTPDLHLSFVHAVERLGGQEKATPKLVFQLMNVRELSIAHVKSHLQRYRS 142
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-2985143IPR009057Homeodomain-like
PROSITE profilePS5129410.54685145IPR017930Myb domain
SuperFamilySSF466891.29E-1487143IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-2289144IPR006447Myb domain, plants
PfamPF002493.1E-790141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MEEGLEILDQ EKIDGCEGQA ENISLMSSQK CSSYDLNEEA SSAEDNGTAE VSNTDGDMRT  60
EGNSANNATS AERNGLRPTV RQYVRSKMPR LRWTPDLHLS FVHAVERLGG QEKATPKLVF  120
QLMNVRELSI AHVKSHLQRY RSKKLDEAGQ DEKSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-1890144458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-1890144458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-1890144458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-1890144458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-1890144458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-1890144458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-1890144458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-1890144458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G067200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024436884.11e-105uncharacterized protein LOC7455902
SwissprotQ700D92e-27MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A3N7FSF91e-104A0A3N7FSF9_POPTR; Uncharacterized protein
STRINGPOPTR_0011s07270.11e-113(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-37G2-like family protein