PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G057700.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 251aa    MW: 28413.2 Da    PI: 7.2203
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G057700.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox634.3e-202883257
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         kR+  t+ ql++Le++++ + yps e+r+eL++klgL++rq ++WF+ rR k++k
  Potri.011G057700.4 28 PKRQMKTPFQLQTLENAYATDTYPSDEMRAELSEKLGLSDRQLQMWFCHRRLKDRK 83
                        69****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-19784IPR009057Homeodomain-like
SuperFamilySSF466891.97E-181585IPR009057Homeodomain-like
PROSITE profilePS5007117.0862484IPR001356Homeobox domain
SMARTSM003891.3E-192688IPR001356Homeobox domain
PfamPF000469.5E-182883IPR001356Homeobox domain
CDDcd000861.25E-162985No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEEANSEGEN HSKSKSNAMN SNEGQSKPKR QMKTPFQLQT LENAYATDTY PSDEMRAELS  60
EKLGLSDRQL QMWFCHRRLK DRKENLVKHR KAAPLPGSPL EDMRIVRADS GSDYGSGSVS  120
GSSPLSESRK VVLDDGHKVR RHYESSPRSV TELRAIACVE AQLGEPLRED GPILGMEFDP  180
LPPDAFGEPI AAITEQPKRM GYSYEDKVYE RRDAKSSKVV SQIHHIFLLF LLCTLHVQCW  240
LRFFCISWLL *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17683RRLKDRKE
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in growing tissues such as inflorescence and flower meristems, young leaves and floral organs. Expressed in roots, rosette and cauline leaves, stems, flowers, inflorescences and siliques. {ECO:0000269|PubMed:22694359}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G057700.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024436990.11e-145homeobox-DDT domain protein RLT1 isoform X2
RefseqXP_024436991.11e-147homeobox-DDT domain protein RLT1 isoform X3
SwissprotF4HY567e-52RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A2K1YG451e-144A0A2K1YG45_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05660.11e-120(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.17e-48homeobox-1