PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G057700.2
Common NamePOPTR_0011s05660g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1676aa    MW: 188745 Da    PI: 5.9025
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G057700.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox551.4e-17352857
                        -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                        t+ ql++Le++++ + yps e+r+eL++klgL++rq ++WF+ rR k++k
  Potri.011G057700.2  3 TPFQLQTLENAYATDTYPSDEMRAELSEKLGLSDRQLQMWFCHRRLKDRK 52
                        889*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003896.1E-13157IPR001356Homeobox domain
PROSITE profilePS5007115.953153IPR001356Homeobox domain
SuperFamilySSF466891.58E-14254IPR009057Homeodomain-like
CDDcd000863.05E-14254No hitNo description
Gene3DG3DSA:1.10.10.604.4E-16354IPR009057Homeodomain-like
PfamPF000463.2E-15352IPR001356Homeobox domain
SMARTSM005711.2E-21494553IPR018501DDT domain
PROSITE profilePS5082716.715494553IPR018501DDT domain
PfamPF027911.7E-17495550IPR018501DDT domain
PfamPF050664.3E-15676744IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156122.1E-6885928IPR028942WHIM1 domain
PfamPF156133.5E-1310671139IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1676 aa     Download sequence    Send to blast
MKTPFQLQTL ENAYATDTYP SDEMRAELSE KLGLSDRQLQ MWFCHRRLKD RKENLVKHRK  60
AAPLPGSPLE DMRIVRADSG SDYGSGSVSG SSPLSESRKV VLDDGHKVRR HYESSPRSVT  120
ELRAIACVEA QLGEPLREDG PILGMEFDPL PPDAFGEPIA AITEQPKRMG YSYEDKVYER  180
RDAKSSKVAP NKYHFLQDPA SIRSDTYGPH IQSPYHDSPV DTLRGRASPF GVGQIPRARL  240
LSQQDKRGHV FSSTQRDGDY LLQQDTFTKN RTSAQSISHP IMGLENPNVF SDAQTFHNDT  300
ELQLERKHKI DEPRTAREVE AYEIRTRKEL EKQDILRRKN EERMKKEMER LDRERRKEEE  360
RLMREKQREE ERSLREQKRE LERREKFMQK EYLRTEKIRQ KEELRREKEA VKRKAAMEKA  420
TARKIAKDSL DLIEDEQLEL MELIAASKGL ASIVNLNYDT LQNLDSFRDL LITFPSEAVQ  480
LKKSFGFQPW LDSEENIGNL LMVWKFFITF ADVLGLWPFT LDEFVQAFHD YDSRLLGELH  540
VALLKLIIKD IEDVARTPSS GLGINQYYTA NPEGGHPQIV QGAHTWGFDI RNWQQHLNSL  600
TWPEILRQLA LSAGFGPRLK KKCATWAGLG DIDEVKDCED IVSIIRNGSA AENAFVLMRE  660
KGLLLPRRSR HRLTPGTVKF AAFHVLSLEG SKGLTVLELA DRIQKSGLRD LTTSKTPEAS  720
ISVALTRDQK LFERIAPSTY CVRAAFRKDP ADAEAILAEA RKKIRIFENG FLGGEDADDV  780
ERDEDSEGDA DEDPEVDDLA TPMSSNKSTV HSSKVNALSG SGSGKVSNDA SLTVQNKCEK  840
GLSSFSLNGP KDAVAPSIIE QCVTHKDEGT NNADEENIEI DENNSGESWI QGLTEGEYSH  900
LSVEERLSAL VVLVGISNEG NSIRAVLEDR LEAANVLKKQ MWAEAQLDRS RLKEEFISKL  960
DFPSFTGGKV ETQVTSSAVE GSQSPLVLVD GKNKEASPSN AEDQKPLPED AENHGSCALS  1020
EKALVIQDLS LNPDNISAQQ HGYASKRSRS QLKAYIAHLA EEMCIYRSLP LGQDRRRNRY  1080
WQFVASASRN DPCSGRIFVE LHDGNWRVID SEEAFDTLLS SLDTRGVRES HLCIMLQKIE  1140
LSFKENVRRN LGSANIVPSS MVCVSSSDTL DAFSLFSIEL GRNSAEKKGA LKRYQDFQNW  1200
MWKECFNSST LCAVKYGKKR CEQLLDTCDL CLDTYLSEDP HCLSCHQTFK FENKKFEFAE  1260
HEIQCKKKRK VDPGNACTCD SSLPPGTRLL TALLSCIEVS VPQEALESFW MGIPRKDWGM  1320
KLAMPSSTEE LLQILTVFES AIKRERLSSN FEMTKELLGS SALSGSAAHD SASLGLVPVL  1380
PWMPKTTAAV ALRLFELDAS IIYVKNEKPK PSADKPVKLY MKLSSRYSPF KNEDVELKDT  1440
KQEEHIKEDI VDLRGKQSSY KRGRGRRDQG LATKWQRRMP GLKSDTGRKS SSRGTQNLNQ  1500
GPRQQGKKTN LQATSRGRRT VRKRRVEKMQ PKEPLLGRIT DKVASTSYLS KKSAVHNNYV  1560
KSFGNIGDED WSVKKGRMNG DDNSNIMEEA ESDDNVEEVY GQGNWEPGFS GISNGWNRNP  1620
MEVSDDDANV SNGIEAMGDD DSEGDMEMSD GSDRAANRVQ SDEGMDSADS DEYSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14552RRLKDRKE
212651270KKKRKV
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in growing tissues such as inflorescence and flower meristems, young leaves and floral organs. Expressed in roots, rosette and cauline leaves, stems, flowers, inflorescences and siliques. {ECO:0000269|PubMed:22694359}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G057700.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024436990.10.0homeobox-DDT domain protein RLT1 isoform X2
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A2K1YG450.0A0A2K1YG45_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05660.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1