PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G057700.1
Common NamePOPTR_0011s05660g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HB-other
Protein Properties Length: 1721aa    MW: 193436 Da    PI: 5.5466
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G057700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.7e-192883257
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         kR+  t+ ql++Le++++ + yps e+r+eL++klgL++rq ++WF+ rR k++k
  Potri.011G057700.1 28 PKRQMKTPFQLQTLENAYATDTYPSDEMRAELSEKLGLSDRQLQMWFCHRRLKDRK 83
                        69****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-18784IPR009057Homeodomain-like
SuperFamilySSF466893.25E-171685IPR009057Homeodomain-like
PROSITE profilePS5007117.0862484IPR001356Homeobox domain
SMARTSM003891.3E-192688IPR001356Homeobox domain
PfamPF000461.3E-162883IPR001356Homeobox domain
CDDcd000862.10E-152985No hitNo description
SMARTSM005711.2E-21515574IPR018501DDT domain
PROSITE profilePS5082716.715515574IPR018501DDT domain
PfamPF027911.7E-17516571IPR018501DDT domain
PfamPF050664.4E-15697765IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156122.2E-6906949IPR028942WHIM1 domain
PfamPF156133.6E-1310881160IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1721 aa     Download sequence    Send to blast
MEEANSEGEN HSKSKSNAMN SNEGQSKPKR QMKTPFQLQT LENAYATDTY PSDEMRAELS  60
EKLGLSDRQL QMWFCHRRLK DRKENLVKHR KAAPLPGSPL EDMRIVRADS GSDYGSGSVS  120
GSSPLSESRK VVLDDGHKVR RHYESSPRSV TELRAIACVE AQLGEPLRED GPILGMEFDP  180
LPPDAFGEPI AAITEQPKRM GYSYEDKVYE RRDAKSSKDP ASIRSDTYGP HIQSPYHDSP  240
VDTLRGRASP FGVGQIPRAR LLSQQDKRGH VFSSTQRDGD YLLQQDTFTK NRTSAQSISH  300
PIMGLENPNV FSDAQTFHND TELQLERKHK IDEPRTAREV EAYEIRTRKE LEKQDILRRK  360
NEERMKKEME RLDRERRKEE ERLMREKQRE EERSLREQKR ELERREKFMQ KEYLRTEKIR  420
QKEELRREKE AVKRKAAMEK ATARKIAKDS LDLIEDEQLE LMELIAASKG LASIVNLNYD  480
TLQNLDSFRD LLITFPSEAV QLKKSFGFQP WLDSEENIGN LLMVWKFFIT FADVLGLWPF  540
TLDEFVQAFH DYDSRLLGEL HVALLKLIIK DIEDVARTPS SGLGINQYYT ANPEGGHPQI  600
VQGAHTWGFD IRNWQQHLNS LTWPEILRQL ALSAGFGPRL KKKCATWAGL GDIDEVKDCE  660
DIVSIIRNGS AAENAFVLMR EKGLLLPRRS RHRLTPGTVK FAAFHVLSLE GSKGLTVLEL  720
ADRIQKSGLR DLTTSKTPEA SISVALTRDQ KLFERIAPST YCVRAAFRKD PADAEAILAE  780
ARKKIRIFEN GFLGGEDADD VERDEDSEGD ADEDPEVDDL ATPMSSNKST VHSSKVNALS  840
GSGSGKVSND ASLTVQNKCE KGLSSFSLNG PKDAVAPSII EQCVTHKDEG TNNADEENIE  900
IDENNSGESW IQGLTEGEYS HLSVEERLSA LVVLVGISNE GNSIRAVLED RLEAANVLKK  960
QMWAEAQLDR SRLKEEFISK LDFPSFTGGK VETQVTSSAV EGSQSPLVLV DGKNKEASPS  1020
NAEDQKPLPE DAENHGSCAL SEKALVIQDL SLNPDNISAQ QHGYASKRSR SQLKAYIAHL  1080
AEEMCIYRSL PLGQDRRRNR YWQFVASASR NDPCSGRIFV ELHDGNWRVI DSEEAFDTLL  1140
SSLDTRGVRE SHLCIMLQKI ELSFKENVRR NLGSANIVCQ SGTTDEKETA ETDTADCPAD  1200
DSPSSMVCVS SSDTLDAFSL FSIELGRNSA EKKGALKRYQ DFQNWMWKEC FNSSTLCAVK  1260
YGKKRCEQLL DTCDLCLDTY LSEDPHCLSC HQTFKFENKK FEFAEHEIQC KKKRKVDPGN  1320
ACTCDSSLPP GTRLLTALLS CIEVSVPQEA LESFWMGIPR KDWGMKLAMP SSTEELLQIL  1380
TVFESAIKRE RLSSNFEMTK ELLGSSALSG SAAHDSASLG LVPVLPWMPK TTAAVALRLF  1440
ELDASIIYVK NEKPKPSADK PVKLYMKLSS RYSPFKNEDV ELKDTKQEEH IKEDIVDLRG  1500
KQSSYKRGRG RRDQGLATKW QRRMPGLKSD TGRKSSSRGT QNLNQGPRQQ GKKTNLQATS  1560
RGRRTVRKRR VEKMQPKEPL LGRITDKVAS TSYLSKKSAV HNNYVKSFGN IGDEDWSVKK  1620
GRMNGDDNSN IMEEAESDDN VEEVYGQGNW EPGFSGISNG WNRNPMEVSD DDANVSNGIE  1680
AMGDDDSEGD MEMSDGSDRA ANRVQSDEGM DSADSDEYSD *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17683RRLKDRKE
213101315KKKRKV
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in growing tissues such as inflorescence and flower meristems, young leaves and floral organs. Expressed in roots, rosette and cauline leaves, stems, flowers, inflorescences and siliques. {ECO:0000269|PubMed:22694359}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC. {ECO:0000269|PubMed:22694359}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G057700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024436990.10.0homeobox-DDT domain protein RLT1 isoform X2
SwissprotF4HY560.0RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLA0A2K1YG450.0A0A2K1YG45_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Representative plantOGRP15771634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1