PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G054300.1
Common NamePOPTR_0011s05410g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 326aa    MW: 35711.2 Da    PI: 9.3586
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G054300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.65.7e-382989262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        +++ +kcprC+s ntkfCyynny+lsqPryfCk+CrryWt GG+lrnvPvGgg+rk k+++
  Potri.011G054300.1 29 PQQPQKCPRCESLNTKFCYYNNYNLSQPRYFCKTCRRYWTLGGTLRNVPVGGGCRKGKRAK 89
                        78999***************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.2E-323187IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.633387IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-233487IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MQGGSEDVKP NQERRLKSTQ GDDQQQHQPQ QPQKCPRCES LNTKFCYYNN YNLSQPRYFC  60
KTCRRYWTLG GTLRNVPVGG GCRKGKRAKT SSSSSSGENS RLQQQLPQQP HLLQHNFATP  120
QNILATNNSG NLSSPALRNK ESGNLVSPPA PGMSTMGSYF PGGGFFTSLE AIQSLNNNQP  180
PIQSFPLQPL NQPVNLGGVL GETSNLGLLH GFNAVPAFGS QNQQQSQFYH VGYRDTRSIE  240
HSFYPHNQES LIQSSRPATS SHQQQNWHHG FMSNSSPTVS DTALWSTSTS TTIGHTNSNI  300
NPTAGSSPLN PDQWKHDLPG YGPPS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G054300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006377380.10.0dof zinc finger protein 1
TrEMBLU5G1110.0U5G111_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-32OBF binding protein 4