PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G047500.1
Common NamePOPTR_0011s04730g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 306aa    MW: 33893.5 Da    PI: 8.2685
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G047500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.51.9e-3545102461
              zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         + lkcprC+stntkfCyynny+ sqPr+fCk+C+r+WtkGG lrnvPvGggr++++++
  Potri.011G047500.1  45 EPLKCPRCESTNTKFCYYNNYNKSQPRHFCKSCKRHWTKGGNLRNVPVGGGRKNKRQK 102
                         5789***********************************************8777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.9E-3146100IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2247100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.44747101IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104985IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGLSSKQVTG DGLDWSQTLL QAHTLELPKP PVIRRQQQQN QLQFEPLKCP RCESTNTKFC  60
YYNNYNKSQP RHFCKSCKRH WTKGGNLRNV PVGGGRKNKR QKTSKTSSNT TTSSSTTAST  120
TAPSNNNSAT NMTNWVNPQL AIQAQQQKQN LPDLVLGGQK DLSEILYQAM INPPSSVLQQ  180
NSISCNNFDT KSFNVNNNGV LLGSSVSIPQ NQGLLFPYSS SFDTHPSSIC TSFQPSNVYN  240
YTGESMEDST ITTTMPPTSS TITHSLQVPN TSSGMDMTNY WNWDDIENYV SADLNVPWDD  300
SEIKP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G047500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316631.10.0dof zinc finger protein 4
TrEMBLB9HYL30.0B9HYL3_POPTR; Uncharacterized protein
STRINGPOPTR_0011s04730.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.15e-28Dof family protein