PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G025000.3
Common NamePOPTR_0011s00520g
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 721aa    MW: 78975.5 Da    PI: 5.6383
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G025000.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
                         688999***********************************************998 PP

               START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         e+a +a++el+++a+a+ep+W +     e +n++e+l++f+++ +      ++ea+r+s+vv+m +++lve+l+d + qW++ +     +a
                         68899********************99999************999********************************.******99999** PP

               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                         +tlev+s+g      galq+m+ae+q++splvp R+ +fvRy++q+++ +w++vdvS+ds  + +    + +++++ Sg+li++++ng+s+
                         ***********************************************************9866.44...899999**************** PP

               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         v+wveh+++++r++h+++r+lv+sgla+gak+wv tl+rqce+
                         *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.89250110IPR001356Homeobox domain
SMARTSM003891.4E-1951114IPR001356Homeobox domain
CDDcd000864.79E-1953111No hitNo description
PfamPF000461.2E-1753108IPR001356Homeobox domain
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
SuperFamilySSF559613.57E-32233463No hitNo description
PROSITE profilePS5084841.878233464IPR002913START domain
CDDcd088753.50E-121237460No hitNo description
SMARTSM002342.9E-61242461IPR002913START domain
PfamPF018528.5E-54242461IPR002913START domain
Gene3DG3DSA:3.30.530.208.1E-4339460IPR023393START-like domain
SuperFamilySSF559615.93E-27480712No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2787661e-150GU278766.1 Populus balsamifera isolate POR11 haplotype A L1 specific homeobox gene (ML1) / ovulespecific homeobox protein A20 gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024436817.10.0homeobox-leucine zipper protein MERISTEM L1 isoform X1
RefseqXP_024436818.10.0homeobox-leucine zipper protein MERISTEM L1 isoform X1
RefseqXP_024436819.10.0homeobox-leucine zipper protein MERISTEM L1 isoform X1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A385JIE60.0A0A385JIE6_POPTO; Protodermal factor 2
TrEMBLB9HZK90.0B9HZK9_POPTR; Uncharacterized protein
STRINGPOPTR_0011s00520.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229