PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G025000.2
Common NamePOPTR_0011s00520g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 715aa    MW: 78334.8 Da    PI: 5.7497
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G025000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85e-2053108156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Potri.011G025000.2  53 KKRYHRHTQRQIQEMEAFFQECPHPDDKQRKELSRELGLDPLQVKFWFQNKRTQMK 108
                         688999***********************************************998 PP

2START207.35.9e-652424611206
                         HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
               START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         e+a +a++el+++a+a+ep+W +     e +n++e+l++f+++ +      ++ea+r+s+vv+m +++lve+l+d + qW++ +     +a
  Potri.011G025000.2 242 EVAVAAMEELMRMAQAGEPLWIQGEnntEVLNEEEYLRTFTRGIGprplgMRSEASRESAVVIMSHVNLVEILMDAN-QWSTIFCgivsRA 331
                         68899********************99999************999********************************.******99999** PP

                         EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                         +tlev+s+g      galq+m+ae+q++splvp R+ +fvRy++q+++ +w++vdvS+ds  + +    + +++++ Sg+li++++ng+s+
  Potri.011G025000.2 332 MTLEVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQHTDATWAVVDVSLDSLCP-SL---MSKCRRRSSGCLIQELPNGYSN 418
                         ***********************************************************9866.44...899999**************** PP

                         EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         v+wveh+++++r++h+++r+lv+sgla+gak+wv tl+rqce+
  Potri.011G025000.2 419 VVWVEHTEVDDRSVHNIYRPLVNSGLAFGAKRWVGTLDRQCER 461
                         *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-2334108IPR009057Homeodomain-like
SuperFamilySSF466891.13E-1936110IPR009057Homeodomain-like
PROSITE profilePS5007116.89250110IPR001356Homeobox domain
SMARTSM003891.4E-1951114IPR001356Homeobox domain
CDDcd000864.71E-1953111No hitNo description
PfamPF000461.1E-1753108IPR001356Homeobox domain
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
SuperFamilySSF559613.57E-32233463No hitNo description
PROSITE profilePS5084841.878233464IPR002913START domain
CDDcd088752.89E-121237460No hitNo description
SMARTSM002342.9E-61242461IPR002913START domain
PfamPF018528.3E-54242461IPR002913START domain
Gene3DG3DSA:3.30.530.208.0E-4339460IPR023393START-like domain
SuperFamilySSF559616.04E-26478706No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
MFDSHHMLDM TPKSSENDLS KLKDDDYETK SGTETMEAPS GDDQDPSGQR PKKKRYHRHT  60
QRQIQEMEAF FQECPHPDDK QRKELSRELG LDPLQVKFWF QNKRTQMKAQ HERSENSILK  120
AENEKLRMEN NRYKEALSSA SCPNCGGPAA LGEMSFDEQH LRIENARLRE EIDRISGIAA  180
KYVGKPLSSL SNLSHHLPSR SLDLGVSNYG AHSGFVGEMF GATALLGAVT GPTEADKPMI  240
VEVAVAAMEE LMRMAQAGEP LWIQGENNTE VLNEEEYLRT FTRGIGPRPL GMRSEASRES  300
AVVIMSHVNL VEILMDANQW STIFCGIVSR AMTLEVLSTG VAGNYNGALQ VMTAEFQVPS  360
PLVPTRENYF VRYCKQHTDA TWAVVDVSLD SLCPSLMSKC RRRSSGCLIQ ELPNGYSNVV  420
WVEHTEVDDR SVHNIYRPLV NSGLAFGAKR WVGTLDRQCE RLASSMAINI PTGDLCGRKS  480
ILKLAERMVM SFCTGVGAST AHTWTTLSAT GSDDVRVMTR KSMDDPGRPP GIVLSAATSF  540
WIPVPSKKVF DFLKDENHRS EWDILSNGGQ VQEMAHIANG RDPGNCVSLL RVNSTNSSQS  600
NMLILQESCT DSTGSYVIYA PVDISAMNIV LSGGDPDYVA LLPSGFAILP DGPGYGPAGI  660
LDVGSGGSLL TVAFQILVDS VPSVKLSLGS VATVNSLIKC TVERIKAAVM CDNP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.7740.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: First expressed in the apical cell after the first asymmetric division of the zygote. Expressed in all proembryo cells until the eight-cell stage, and then restricted to the protoderm in the 16-cell proembryo. Not detected in the torpedo stage, but reappeared later in the L1 layer of the shoot apical meristem in the mature embryo. After germination, the L1 layer-specific expression pattern is maintained in the vegetative shoot apical meristem, inflorescence, floral meristems, and the young floral organ primordia. Finally, expressed in the protoderm of the ovule primordia and integuments and gradually restricted to the endothelium surrounding the embryo sac. {ECO:0000269|PubMed:10571886, ECO:0000269|PubMed:8989876}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in cell specification and pattern formation during embryogenesis. Binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to PDF2. {ECO:0000269|PubMed:11439135, ECO:0000269|PubMed:12505995}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G025000.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2787661e-139GU278766.1 Populus balsamifera isolate POR11 haplotype A L1 specific homeobox gene (ML1) / ovulespecific homeobox protein A20 gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024436817.10.0homeobox-leucine zipper protein MERISTEM L1 isoform X1
RefseqXP_024436818.10.0homeobox-leucine zipper protein MERISTEM L1 isoform X1
RefseqXP_024436819.10.0homeobox-leucine zipper protein MERISTEM L1 isoform X1
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLA0A385JIE60.0A0A385JIE6_POPTO; Protodermal factor 2
TrEMBLB9HZK90.0B9HZK9_POPTR; Uncharacterized protein
STRINGPOPTR_0011s00520.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Takada S,Takada N,Yoshida A
    Induction of epidermal cell fate in Arabidopsis shoots.
    Plant Signal Behav, 2013. 8(11): p. e26236
    [PMID:23989220]
  3. Liang Z,Brown RC,Fletcher JC,Opsahl-Sorteberg HG
    Calpain-Mediated Positional Information Directs Cell Wall Orientation to Sustain Plant Stem Cell Activity, Growth and Development.
    Plant Cell Physiol., 2015. 56(9): p. 1855-66
    [PMID:26220906]
  4. Katagiri Y, et al.
    The coordination of ploidy and cell size differs between cell layers in leaves.
    Development, 2016. 143(7): p. 1120-5
    [PMID:26903507]
  5. Seeliger I, et al.
    The AP2-type transcription factors DORNRĂ–SCHEN and DORNRĂ–SCHEN-LIKE promote G1/S transition.
    Mol. Genet. Genomics, 2016. 291(5): p. 1835-49
    [PMID:27277595]
  6. Schwarz EM,Roeder AH
    Transcriptomic Effects of the Cell Cycle Regulator LGO in Arabidopsis Sepals.
    Front Plant Sci, 2016. 7: p. 1744
    [PMID:27920789]
  7. Meyer HM, et al.
    Fluctuations of the transcription factor ATML1 generate the pattern of giant cells in the Arabidopsis sepal.
    Elife, 2018.
    [PMID:28145865]