PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G025000.1
Common NamePOPTR_0011s00520g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 721aa    MW: 78975.5 Da    PI: 5.6383
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G025000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85.1e-2053108156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Potri.011G025000.1  53 KKRYHRHTQRQIQEMEAFFQECPHPDDKQRKELSRELGLDPLQVKFWFQNKRTQMK 108
                         688999***********************************************998 PP

2START207.36e-652424611206
                         HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
               START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                         e+a +a++el+++a+a+ep+W +     e +n++e+l++f+++ +      ++ea+r+s+vv+m +++lve+l+d + qW++ +     +a
  Potri.011G025000.1 242 EVAVAAMEELMRMAQAGEPLWIQGEnntEVLNEEEYLRTFTRGIGprplgMRSEASRESAVVIMSHVNLVEILMDAN-QWSTIFCgivsRA 331
                         68899********************99999************999********************************.******99999** PP

                         EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEE CS
               START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghsk 163
                         +tlev+s+g      galq+m+ae+q++splvp R+ +fvRy++q+++ +w++vdvS+ds  + +    + +++++ Sg+li++++ng+s+
  Potri.011G025000.1 332 MTLEVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQHTDATWAVVDVSLDSLCP-SL---MSKCRRRSSGCLIQELPNGYSN 418
                         ***********************************************************9866.44...899999**************** PP

                         EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         v+wveh+++++r++h+++r+lv+sgla+gak+wv tl+rqce+
  Potri.011G025000.1 419 VVWVEHTEVDDRSVHNIYRPLVNSGLAFGAKRWVGTLDRQCER 461
                         *****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-2334108IPR009057Homeodomain-like
SuperFamilySSF466891.17E-1936110IPR009057Homeodomain-like
PROSITE profilePS5007116.89250110IPR001356Homeobox domain
SMARTSM003891.4E-1951114IPR001356Homeobox domain
CDDcd000864.79E-1953111No hitNo description
PfamPF000461.2E-1753108IPR001356Homeobox domain
PROSITE patternPS00027085108IPR017970Homeobox, conserved site
SuperFamilySSF559613.57E-32233463No hitNo description
PROSITE profilePS5084841.878233464IPR002913START domain
CDDcd088753.50E-121237460No hitNo description
SMARTSM002342.9E-61242461IPR002913START domain
PfamPF018528.5E-54242461IPR002913START domain
Gene3DG3DSA:3.30.530.208.1E-4339460IPR023393START-like domain
SuperFamilySSF559615.93E-27480712No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
MFDSHHMLDM TPKSSENDLS KLKDDDYETK SGTETMEAPS GDDQDPSGQR PKKKRYHRHT  60
QRQIQEMEAF FQECPHPDDK QRKELSRELG LDPLQVKFWF QNKRTQMKAQ HERSENSILK  120
AENEKLRMEN NRYKEALSSA SCPNCGGPAA LGEMSFDEQH LRIENARLRE EIDRISGIAA  180
KYVGKPLSSL SNLSHHLPSR SLDLGVSNYG AHSGFVGEMF GATALLGAVT GPTEADKPMI  240
VEVAVAAMEE LMRMAQAGEP LWIQGENNTE VLNEEEYLRT FTRGIGPRPL GMRSEASRES  300
AVVIMSHVNL VEILMDANQW STIFCGIVSR AMTLEVLSTG VAGNYNGALQ VMTAEFQVPS  360
PLVPTRENYF VRYCKQHTDA TWAVVDVSLD SLCPSLMSKC RRRSSGCLIQ ELPNGYSNVV  420
WVEHTEVDDR SVHNIYRPLV NSGLAFGAKR WVGTLDRQCE RLASSMAINI PTGDLCVITT  480
PEGRKSILKL AERMVMSFCT GVGASTAHTW TTLSATGSDD VRVMTRKSMD DPGRPPGIVL  540
SAATSFWIPV PSKKVFDFLK DENHRSEWDI LSNGGQVQEM AHIANGRDPG NCVSLLRVNS  600
TNSSQSNMLI LQESCTDSTG SYVIYAPVDI SAMNIVLSGG DPDYVALLPS GFAILPDGPG  660
YGPAGILDVG SGGSLLTVAF QILVDSVPSV KLSLGSVATV NSLIKCTVER IKAAVMCDNP  720
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.7740.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G025000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2787661e-150GU278766.1 Populus balsamifera isolate POR11 haplotype A L1 specific homeobox gene (ML1) / ovulespecific homeobox protein A20 gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024436817.10.0homeobox-leucine zipper protein MERISTEM L1 isoform X1
RefseqXP_024436818.10.0homeobox-leucine zipper protein MERISTEM L1 isoform X1
RefseqXP_024436819.10.0homeobox-leucine zipper protein MERISTEM L1 isoform X1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A385JIE60.0A0A385JIE6_POPTO; Protodermal factor 2
TrEMBLB9HZK90.0B9HZK9_POPTR; Uncharacterized protein
STRINGPOPTR_0011s00520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]