PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G006300.1
Common NamePOPTR_0021s00430g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 115aa    MW: 13454.7 Da    PI: 9.7477
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G006300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.41.6e-333487255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        prlrWtp+LH++Fv+ave+LGG+++AtPk +l++m+v++Lt++hvkSHLQ+YR+
  Potri.011G006300.1 34 PRLRWTPDLHHCFVHAVERLGGEDRATPKMVLQIMDVEDLTISHVKSHLQMYRS 87
                        8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-323089IPR009057Homeodomain-like
PROSITE profilePS512949.8243090IPR017930Myb domain
SuperFamilySSF466894.48E-163288IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-253488IPR006447Myb domain, plants
PfamPF002491.1E-73586IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MRTTERRSVV GVNFQEIGLR SSAIVRPYVR SKMPRLRWTP DLHHCFVHAV ERLGGEDRAT  60
PKMVLQIMDV EDLTISHVKS HLQMYRSMKH EWMIQEEKNS KEMAVFINGI NEFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-213590459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-213590459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-213590459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-213590459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-213590459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-213590459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-213590459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-213590459Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G006300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1495752e-35AC149575.1 Populus trichocarpa clone Pop1-41G18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020541306.12e-46putative Myb family transcription factor At1g14600 isoform X2
SwissprotQ700D92e-28MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLU7E3132e-77U7E313_POPTR; Uncharacterized protein
STRINGPOPTR_0021s00430.13e-78(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.11e-33G2-like family protein