PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G250700.1
Common NamePOPTR_0010s25720g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 126aa    MW: 14233.4 Da    PI: 8.8365
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G250700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.62.4e-3961051100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaC++lrr+C +dCvlapyfp ++p++fa+vhk+FGas++++llk+lp + r da++++  eA  rardPvyG+vgvi++lqqq+  ++
  Potri.010G250700.1   6 RCAACRFLRRRCRQDCVLAPYFPPTNPQRFAYVHKVFGASKITELLKQLPVHLRYDAAECMSIEAASRARDPVYGCVGVISQLQQQIIDVQ 96 
                         6****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         +el+++k +
  Potri.010G250700.1  97 SELVKIKGK 105
                         ***998866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.7635106IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-396102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MSNSTRCAAC RFLRRRCRQD CVLAPYFPPT NPQRFAYVHK VFGASKITEL LKQLPVHLRY  60
DAAECMSIEA ASRARDPVYG CVGVISQLQQ QIIDVQSELV KIKGKLAVHN AQQQLQLEDG  120
ERASEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-3779912104LOB family transfactor Ramosa2.1
5ly0_B1e-3779912104LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G250700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316444.32e-89LOB domain-containing protein 24
TrEMBLA0A2K1YZY83e-88A0A2K1YZY8_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s25720.13e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-32LBD family protein