PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G223300.3
Common NamePOPTR_0010s23010g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 353aa    MW: 38598.2 Da    PI: 5.8448
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G223300.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA551.1e-17256289134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Potri.010G223300.3 256 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 289
                         99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.7E-765341IPR016679Transcription factor, GATA, plant
SMARTSM004013.8E-16250300IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.609250286IPR000679Zinc finger, GATA-type
SuperFamilySSF577166.65E-15254313No hitNo description
Gene3DG3DSA:3.30.50.101.0E-14254287IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.03E-14255302No hitNo description
PROSITE patternPS003440256281IPR000679Zinc finger, GATA-type
PfamPF003202.4E-15256289IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MIGQTNTSSG FMDEIDCGSF FDHIDDLLDF PSDDVDASLP DCTTTNNHAS CFIDNDDNSF  60
PGIWSSQSDS LPGSASDLSA ELSVPYEDIV QLEWLSNFVE DSFSGGSLTM KKEESASVDK  120
KDSTPHHQFQ TSSPVSVLES SSDCSGEKNA PRSPEIVASG KCGRARSKRP RPAAFTPRPA  180
MQLVSPTSSI TEVPQQFVSP RVPSDSESFA ESRLVIKIPE HVDPEHKKKK KIKFIVPSGT  240
VEMNQNSQPQ QAVRKCMHCE ITKTPQWRAG PMGPKTLCNA CGVRYKSGRL FPEYRPAASP  300
TFVPSLHSNS HKKVVEMRAK AGEKITTSRP ATMMVNSPEF IPNESNPAMD YM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1167171KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.82240.0stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G223300.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0106880.0LC010688.1 Populus nigra PniGATA8a mRNA for GATA type zinc finger domain, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316371.30.0GATA transcription factor 8
TrEMBLA0A2I4KL320.0A0A2I4KL32_POPTR; GATA transcription factor
TrEMBLA0A2K1YYK80.0A0A2K1YYK8_POPTR; Uncharacterized protein
STRINGPOPTR_0010s23010.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.24e-43GATA family protein