PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G205400.2
Common NamePOPTR_0010s21240g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 338aa    MW: 35441.4 Da    PI: 9.3925
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G205400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.9e-3973132362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         e alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  Potri.010G205400.2  73 EMALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 132
                         6689*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-3156121IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3275130IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54476130IPR003851Zinc finger, Dof-type
PROSITE patternPS01361078114IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MVFSSIPVYL DPPNWQQQHN NQPPAGAGNE NPQLPPPSGP PTGGGDGGGT TAGSIRPGSM  60
TDRARLAKIP LPEMALKCPR CESTNTKFCY FNNYSLTQPR HFCKTCRRYW TRGGALRNVP  120
VGGGCRRNKR SKGSGRSKSP VKAGSSSSGG LSSNGGTTDI TGNMTTPPPL LPIFPPLHHL  180
GDYNSPDIGL NFGGILPSVG ATAGGGGGVE FQMENSTSSN SVGGSVLSSG LVEQWRLQQV  240
QHQVQQYPFL SNLEPSSGLY SFEGGGIGPS NYAGQIRSRP LDSTGVSQLA SVKMEGNQGL  300
NLSRNFLGIS GNDQYWGGNN AWTDLPGFTS SSTSHLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13749SGPPTGGGDGGGT
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G205400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006378711.10.0dof zinc finger protein DOF3.6 isoform X2
TrEMBLB9NBE60.0B9NBE6_POPTR; Uncharacterized protein
STRINGPOPTR_0010s21240.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.13e-39DNA binding with one finger 2.4