PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G204800.1
Common NamePOPTR_0010s21240g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 321aa    MW: 33438.1 Da    PI: 9.6104
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G204800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.5e-3956115362
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         e alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  Potri.010G204800.1  56 EMALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 115
                         6689*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3039104IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3258113IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54459113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
QHNNQPPAGA GNENPQLPPP SGPPTGGGDG GGTTAGSIRP GSMTDRARLA KIPLPEMALK  60
CPRCESTNTK FCYFNNYSLT QPRHFCKTCR RYWTRGGALR NVPVGGGCRR NKRSKGSGRS  120
KSPVKAGSSS SGGLSSNGGT TDITGNMTTP PPLLPIFPPL HHLGDYNSPD IGLNFGGILP  180
SVGATAGGGG GVEFQMENST SSNSVGGSVL SSGLVEQWRL QQVQHQVQQY PFLSNLEPSS  240
GLYSFEGGGI GPSNYAGQIR SRPLDSTGVS QLASVKMEGN QGLNLSRNFL GISGNDQYWG  300
GNNAWTDLPG FTSSSTSHLL *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12032SGPPTGGGDGGGT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G204800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006378711.10.0dof zinc finger protein DOF3.6 isoform X2
TrEMBLA0A2K1YXG80.0A0A2K1YXG8_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s21240.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-41OBF-binding protein 3