PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G202300.1
Common NamePOPTR_0010s20980g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRAS
Protein Properties Length: 486aa    MW: 53962.7 Da    PI: 5.2063
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G202300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS221.15.5e-682664821219
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL+ cAeav++++ + a  lL++++++a p+gd+mqRla +f+ +L+arla+s++++ykal +++ts    +++l a+++   ++P+ 
  Potri.010G202300.1 266 LRTLLTLCAEAVAADNRRSAIDLLKQIRQNAPPTGDAMQRLANVFADGLEARLAGSGTQIYKALISRPTS---AADVLEAYHMVLTACPFR 353
                         5789*****************************************************************9...89999************* PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k+s++  N +I + +e+++rvHi+Df+i++G+QWp+L+q L+sRp+gpp+lRiTg++ p++g   +e++eetg+rL+++A++++vpfefn+
  Potri.010G202300.1 354 KLSNFFSNITIKKIAENATRVHIVDFGIMYGFQWPSLIQRLSSRPGGPPKLRITGIDLPNPGfrPAERVEETGRRLENYANTFKVPFEFNA 444
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvs 219
                          +a+ ++++++e+L+++++E+l+Vn+ ++l +llde++ 
  Potri.010G202300.1 445 -IAQMWDTVQIEDLKIDRNEVLVVNSLFRLRNLLDETGG 482
                         .7********************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.837240485IPR005202Transcription factor GRAS
PfamPF035141.9E-65266482IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MSQEVDSHED FDFSDVVLKY ISQMLMEEEM EDKTCMFQES SAALLAAEQS LYELIGNYTS  60
STSRSSGSNL VDLGEYKFSR RASQFASRSS YSSGNSTVIV DGYVDSPVGP NMVAEIFRES  120
ESVMQFKKGF EEARKFIPNG DLFTDLEING LFLRDPKEDA KDVLGMTEEK NENENHTDGL  180
RRKKSPHLEE LALEGFRSNK QSAVYSESTA SPADFDMVLL NCGRDESSIR AALHNGESKI  240
VQQNGQAKGG KARGKRQGGK RNVVDLRTLL TLCAEAVAAD NRRSAIDLLK QIRQNAPPTG  300
DAMQRLANVF ADGLEARLAG SGTQIYKALI SRPTSAADVL EAYHMVLTAC PFRKLSNFFS  360
NITIKKIAEN ATRVHIVDFG IMYGFQWPSL IQRLSSRPGG PPKLRITGID LPNPGFRPAE  420
RVEETGRRLE NYANTFKVPF EFNAIAQMWD TVQIEDLKID RNEVLVVNSL FRLRNLLDET  480
GGGES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-282664805218GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.10920.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315253.20.0hypothetical protein POPTR_0010s20980g
SwissprotQ9XE581e-124SCL14_ARATH; Scarecrow-like protein 14
TrEMBLB9HTX40.0B9HTX4_POPTR; Uncharacterized protein
STRINGPOPTR_0010s20980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP26615129
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-109SCARECROW-like 14