PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G193000.1
Common NamePOPTR_0010s20040g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 294aa    MW: 33521.7 Da    PI: 6.8054
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G193000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.66e-13121165347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
  Potri.010G193000.1 121 PWTEDEHRRFLMGLLKHGKGDWRNISRNFVVSKTPTQVASHAQKY 165
                         8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.7071772IPR017884SANT domain
SMARTSM007171.3E-41870IPR001005SANT/Myb domain
SuperFamilySSF466894.93E-102074IPR009057Homeodomain-like
CDDcd001671.39E-52167No hitNo description
PROSITE profilePS5129418.827114170IPR017930Myb domain
SuperFamilySSF466897.48E-16115170IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-17117169IPR006447Myb domain, plants
SMARTSM007173.2E-10118168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-10118164IPR009057Homeodomain-like
CDDcd001675.02E-8121166No hitNo description
PfamPF002492.8E-10121165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
METLNPSWYM SNSNWFTQTT EWTREENKEF EIALAIFDEH EPDRWLKVAA MIPGKTVYDV  60
IKQYKELEED VSDIEAGRVP VPGYLSSSFT FQLVGNSNFD AYRKRSLTAK SADQQRKKGV  120
PWTEDEHRRF LMGLLKHGKG DWRNISRNFV VSKTPTQVAS HAQKYFIRQQ LSGVKDKRRP  180
SIHDITTVNL ADATTPSDGD EPSSLDQSDL LLSQQKPAGM QKVLIDWDEA KDGSIMVFDS  240
THEDLFKSSP YEIPSNGLKF QGQNLCVGAH HGARINPHNM VFKLPPPRFQ IQY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-14221101193RADIALIS
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}.
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G193000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316232.10.0transcription factor DIVARICATA
SwissprotQ8S9H71e-97DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB9HT090.0B9HT09_POPTR; Uncharacterized protein
STRINGPOPTR_0010s20040.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.12e-86MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]