PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G192100.1
Common NamePOPTR_0010s19950g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WOX
Protein Properties Length: 172aa    MW: 19618 Da    PI: 7.5066
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G192100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.43.3e-202889157
                        TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        ++ R+++t+eq++ L +lF++  r+ps++e++ ++++l    +++ ++V++WFqN++a+e++
  Potri.010G192100.1 28 KCGRWNPTTEQVKLLTDLFRSgLRTPSTDEIQNISTQLsfygKIESKNVFYWFQNHKARERQ 89
                        568*****************99**************************************97 PP

2Wus_type_Homeobox112.71.8e-362891265
   Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        ++ RW+Pt+eQ+k+L++l++sGlrtP+++eiq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
  Potri.010G192100.1 28 KCGRWNPTTEQVKLLTDLFRSGLRTPSTDEIQNISTQLSFYGKIESKNVFYWFQNHKARERQKR 91
                        678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.8512590IPR001356Homeobox domain
SMARTSM003897.5E-42794IPR001356Homeobox domain
PfamPF000463.4E-172989IPR001356Homeobox domain
SuperFamilySSF466891.15E-113092IPR009057Homeodomain-like
CDDcd000861.00E-43191No hitNo description
Gene3DG3DSA:1.10.10.606.6E-83189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MEERMSGFCI TKAGRGGGSG NNCGTGTKCG RWNPTTEQVK LLTDLFRSGL RTPSTDEIQN  60
ISTQLSFYGK IESKNVFYWF QNHKARERQK RRRVSVDEKD AMIHFTEINH VNEPERVIET  120
LQLFPLNSFD EAGPEKFRFQ ANECNEAAAA FSYKFGTEMD HPHLDLRLSF V*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18993KRRRV
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specifically expressed in the hypophysis of the majority of early globular embryos, approximately one round of cell division after the 16-cell stage, but never at the 16-cell stage itself. After the division of the hypophysis, it is detected in the upper lens-shaped cell that gives rise to the QC, but not in the lower daughter cell that gives rise to the central root cap. Subsequently, in heart stage and bent cotyledon stage embryos, it is detected in the four cells of the QC, which are the direct descendants of the lens-shaped cell. Also expressed in patches of cells that appeared associated with the vascular primordium of the cotyledons. This expression is strongest in late heart stage embryos and then gradually decreases. {ECO:0000269|PubMed:14711878}.
UniprotTISSUE SPECIFICITY: Specifically expressed in the central cells of a quiescent center (QC) of the root. {ECO:0000269|PubMed:14711878}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor, which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269|PubMed:25631790}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G192100.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9827061e-166KF982706.1 Populus tomentosa WOX5b (WOX5b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315173.21e-114WUSCHEL-related homeobox 7
SwissprotQ8H1D25e-58WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLA0A1L6K4W91e-124A0A1L6K4W9_POPTO; Homeobox-leucine zipper transcription factor family protein-like 2
STRINGPOPTR_0010s19950.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60143452
Representative plantOGRP84061116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.14e-51WUSCHEL related homeobox 5
Publications ? help Back to Top
  1. Conte MG,Gaillard S,Droc G,Perin C
    Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants.
    BMC Genomics, 2008. 9: p. 183
    [PMID:18426584]
  2. Chu H, et al.
    A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice.
    J. Exp. Bot., 2013. 64(17): p. 5359-69
    [PMID:24043854]
  3. Tian H,Niu T,Yu Q,Quan T,Ding Z
    Auxin gradient is crucial for the maintenance of root distal stem cell identity in Arabidopsis.
    Plant Signal Behav, 2013. 8(12): p. e26429
    [PMID:24056047]
  4. Tian H,Jia Y,Niu T,Yu Q,Ding Z
    The key players of the primary root growth and development also function in lateral roots in Arabidopsis.
    Plant Cell Rep., 2014. 33(5): p. 745-53
    [PMID:24504658]
  5. Reyes-Hernández BJ, et al.
    The root indeterminacy-to-determinacy developmental switch is operated through a folate-dependent pathway in Arabidopsis thaliana.
    New Phytol., 2014. 202(4): p. 1223-36
    [PMID:24635769]
  6. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  7. Ji H, et al.
    PRL1 modulates root stem cell niche activity and meristem size through WOX5 and PLTs in Arabidopsis.
    Plant J., 2015. 81(3): p. 399-412
    [PMID:25438658]
  8. Su YH,Liu YB,Bai B,Zhang XS
    Establishment of embryonic shoot-root axis is involved in auxin and cytokinin response during Arabidopsis somatic embryogenesis.
    Front Plant Sci, 2014. 5: p. 792
    [PMID:25642237]
  9. Jia Y, et al.
    The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development.
    J. Exp. Bot., 2015. 66(15): p. 4631-42
    [PMID:25998905]
  10. Zhang M, et al.
    A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis.
    Plant J., 2015. 83(4): p. 582-99
    [PMID:26072661]
  11. Kong X,Lu S,Tian H,Ding Z
    WOX5 is Shining in the Root Stem Cell Niche.
    Trends Plant Sci., 2015. 20(10): p. 601-603
    [PMID:26440429]
  12. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]
  13. Zhang Y,Jiao Y,Jiao H,Zhao H,Zhu YX
    Two-Step Functional Innovation of the Stem-Cell Factors WUS/WOX5 during Plant Evolution.
    Mol. Biol. Evol., 2017. 34(3): p. 640-653
    [PMID:28053005]
  14. Singh S, et al.
    Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components.
    Sci Rep, 2017. 7: p. 42450
    [PMID:28195159]
  15. García-Gómez ML,Azpeitia E,Álvarez-Buylla ER
    A dynamic genetic-hormonal regulatory network model explains multiple cellular behaviors of the root apical meristem of Arabidopsis thaliana.
    PLoS Comput. Biol., 2017. 13(4): p. e1005488
    [PMID:28426669]
  16. Long Y, et al.
    In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots.
    Nature, 2017. 548(7665): p. 97-102
    [PMID:28746306]
  17. Bruno L, et al.
    In Arabidopsis thaliana Cadmium Impact on the Growth of Primary Root by Altering SCR Expression and Auxin-Cytokinin Cross-Talk.
    Front Plant Sci, 2017. 8: p. 1323
    [PMID:28798767]
  18. Hu B, et al.
    Divergent regeneration-competent cells adopt a common mechanism for callus initiation in angiosperms.
    Regeneration (Oxf), 2017. 4(3): p. 132-139
    [PMID:28975033]
  19. Lozano-Elena F,Planas-Riverola A,Vilarrasa-Blasi J,Schwab R,Caño-Delgado AI
    Paracrine brassinosteroid signaling at the stem cell niche controls cellular regeneration.
    J. Cell. Sci., 2019.
    [PMID:29242230]
  20. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  21. Dolzblasz A, et al.
    Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4.
    Int J Mol Sci, 2018.
    [PMID:29538317]