PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G185700.1
Common NamePOPTR_0010s19310g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 351aa    MW: 39237.6 Da    PI: 8.8214
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G185700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.33.1e-3270123255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH +Fv+ave+LGG+++AtPk +l++m++kgL+++hvkSHLQ+YR+
  Potri.010G185700.1  70 PRLRWTPDLHLCFVHAVERLGGQDRATPKLVLQMMNIKGLSIAHVKSHLQMYRS 123
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.52466126IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-3066125IPR009057Homeodomain-like
SuperFamilySSF466894.84E-1568125IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-2370124IPR006447Myb domain, plants
PfamPF002491.5E-971122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MEESDNFGGS KSSYSNKEVE QDEGDEEEVD KISFKSRNEG VSTSNSSVEE NEKEAASTGS  60
VRQYIRSKMP RLRWTPDLHL CFVHAVERLG GQDRATPKLV LQMMNIKGLS IAHVKSHLQM  120
YRSKRSDEPN QDSKLVYPNN LSLSLSPSRY GDASWRGHDH QMYSPYKGGT ALNRFKHGLY  180
SSVSERLVIG RNNHNSLNYD SSINIPSLNV QATSRTHQFL EGVKLFQVSR QEESRPSSME  240
SNFIAKLQER SGIDQKECLN TTSSADKNWR TIQEMQKGSK RKTLDSDCNL DLNLALKRST  300
KDDDGLQKCV ADGSLSVSLS SSSSSKLGRS MEGDGRRKHA RMASTLDLTL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G185700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035900.10.0PREDICTED: putative two-component response regulator ARR21
TrEMBLB9HHT81e-169B9HHT8_POPTR; Uncharacterized protein
STRINGPOPTR_0010s19310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.15e-41G2-like family protein