PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G181300.1
Common NamePOPTR_0010s18860g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family M-type_MADS
Protein Properties Length: 228aa    MW: 24748.9 Da    PI: 9.4291
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G181300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF37.23.7e-1213431242
                        HHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
              SRF-TF 12 tfskRrngilKKAeELSvLCdaevaviifss 42
                        ++ kR+++i KKA EL +LCd+ v+v+i  +
  Potri.010G181300.1 13 SYKKRQTTIEKKATELAILCDVPVCVVIKNN 43
                        89*************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006610.302144IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-11964IPR002100Transcription factor, MADS-box
PfamPF003192.9E-101348IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MTPVTVNKGQ EKSYKKRQTT IEKKATELAI LCDVPVCVVI KNNTDGRVST VPQDRGQAVD  60
ILFSYKRKLQ AELVTGNAKS KVVKQDETWD PSFNNLPEEN LMEFMKELEE KSKMVDEAIK  120
RKQEVASKKG RGKRLHAGDG STEVGNKKAK GNIVLDSRTT NSSFSTDSGL DSSGSSTSSN  180
TGFSDGVSIP RRLTGGTFAG EIDNDTDIEA LPASTVRPVK LFGIFLN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120134RKQEVASKKGRGKRL
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G181300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316181.21e-166uncharacterized protein LOC7474401
TrEMBLA0A2K1YW431e-164A0A2K1YW43_POPTR; Uncharacterized protein
STRINGPOPTR_0010s18860.11e-165(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2828733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.13e-08AGAMOUS-like 103