PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G174100.1
Common NamePOPTR_0010s18130g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 357aa    MW: 39535 Da    PI: 8.3306
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G174100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-333286155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Potri.010G174100.1 32 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 86
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-322987IPR009057Homeodomain-like
PROSITE profilePS5129412.3472989IPR017930Myb domain
SuperFamilySSF466891.61E-163187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-233287IPR006447Myb domain, plants
PfamPF002491.1E-73484IPR001005SANT/Myb domain
PfamPF143797.6E-21125164IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MFHTKKPSTM NSHDRPMCVQ GDSGLVLTTD PKPRLRWTVE LHERFVDAVT QLGGPDKATP  60
KTIMRVMGVK GLTLYHLKSH LQKFRLGKQP HKDFNDHSIK DASALDLQRS AASSSGMMSR  120
SMNEMQMEVQ RRLHEQLEVQ RHLQLRTEAQ GKYIQSLLEK ACQTLAGDQN LASGSYKGMG  180
NQGIPGMGAM KEFGTLNFPA FQDLNIYGGD QLDLQHNMDR PSLDGFMPNN DNICLGKKRP  240
SPYDGSGKSP LIWPDDLRLQ DLGSGPACLE PQDDPFKGDQ IQMAPPSMDR GTDLDSISDM  300
YEIKPALQGD ALDEKKFEAS AKLKRPSPRR SPLAAERMSP MINTGAMPQG RNSPFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-193288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-193288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-193288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-193288157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specifically expressed in the developing protophloem sieve elements soon after the phloem-specific cell divisions have taken place. Also found in the companion cells and metaphloem sieve elements. May not be necessary for the initial steps of protophloem differentiation. {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061}.
UniprotTISSUE SPECIFICITY: Expressed in shoots and roots, specifically in the developing protophloem sieve elements (PubMed:14614507). Detected in phloem and/or cambium (PubMed:15923329). Expressed in the phloem tissues of various organs, including leaves and cotyledons, during vegetative growth (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:15923329, ECO:0000269|PubMed:26239308}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G174100.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6755620.0AY675562.1 Populus tomentosa myb family transcription factor-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315080.20.0myb family transcription factor APL isoform X2
SwissprotQ9SAK51e-131APL_ARATH; Myb family transcription factor APL
TrEMBLB9HYB70.0B9HYB7_POPTR; Uncharacterized protein
STRINGPOPTR_0010s18130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49643252
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-123G2-like family protein
Publications ? help Back to Top
  1. Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R
    Vascular gene expression: a hypothesis.
    Front Plant Sci, 2013. 4: p. 261
    [PMID:23882276]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kondo Y, et al.
    Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells.
    Plant Cell, 2016. 28(6): p. 1250-62
    [PMID:27194709]
  4. Shibuta M,Abe M
    FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells.
    Plant Cell Physiol., 2017. 58(11): p. 2017-2025
    [PMID:29036620]