PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.010G167900.1
Common NamePOPTR_0010s17510g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 196aa    MW: 22179.3 Da    PI: 8.4603
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.010G167900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.12e-331771155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprl+Wt+eLH+rFveav+qLGG+++AtPk+++++m+++gLtl+h+kSHLQkYRl
  Potri.010G167900.1 17 KPRLKWTQELHQRFVEAVNQLGGADRATPKSLMRVMEIPGLTLYHLKSHLQKYRL 71
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.0321474IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-311573IPR009057Homeodomain-like
SuperFamilySSF466892.69E-171672IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-231772IPR006447Myb domain, plants
PfamPF002492.0E-81970IPR001005SANT/Myb domain
PfamPF143795.5E-23128175IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGLRHQNMNL VLSTDGKPRL KWTQELHQRF VEAVNQLGGA DRATPKSLMR VMEIPGLTLY  60
HLKSHLQKYR LGKSQQSLIS IENNQEVLFV ADAKEIQSSD DHFQESAFIQ SSGGICSDGN  120
QHPINGSFQI AQALQMQMEV KRKLHEQIEV QRHLQLRIEA QGKYLQSVLK KAQETLAGYN  180
SYSMGVELAF NIYDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-221673158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-221673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-221673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-221673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-221673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-221673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-221673158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-221673158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.010G167900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011013317.11e-135PREDICTED: uncharacterized protein LOC105117364
SwissprotF4I2741e-69PHL8_ARATH; Myb family transcription factor PHL8
TrEMBLA0A2K1YVD41e-142A0A2K1YVD4_POPTR; Uncharacterized protein
STRINGPOPTR_0010s17510.11e-133(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52183253
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.15e-72G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]